ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_031350 ()

glucosamine--fructose-6-phosphate aminotransferase (isomerizing), putative, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10304

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • PF10_0245 glucosamine-fructose-6-phosphate aminotransferase, putative
  • PBANKA_050930 glucosamine--fructose-6-phosphate aminotransferase, putative
  • PY00101 glucosamine-fructose-6-phosphate aminotransferase
  • PVX_111455 glucosamine--fructose-6-phosphate aminotransferase, putative
  • PCHAS_050940 glucosamine--fructose-6-phosphate aminotransferase, putative
  • PKH_060930 glucosamine-fructose-6-phosphate aminotransferase, putative
  • TGME49_031350 glucosamine--fructose-6-phosphate aminotransferase (isomerizing), putative
  • NCLIV_031610 Glucosamine--fructose-6-phosphate aminotransferase (Isomerizing) (EC 2.6.1.16), related
  • cgd1_3730 glucosamine-fructose-6-phosphate aminotransferase
  • Chro.10420 glucosamine-fructose-6-phosphate aminotransferase
  • CMU_019860 glucosamine--fructose-6-phosphate aminotransferase, isomerizing family protein
  • TP02_0935 glucosamine-fructose-6-phosphate aminotransferase, putative
  • TA15930 glucosamine--fructose-6-phosphate aminotransferase, putative
  • BBOV_IV000250 glucosamine--fructose-6-phosphate aminotransferase
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_031350 glucosamine--fructose-6-phosphate aminotransferase (isomerizing), putative
MEGLEILQNRGYDSCGITSISPEGQLVTTKFASRGTTCDSIEILRREGKHPHRGNHIGIAHTRWATHGSKTDENAHPHHD
WKDRISLVHNGTIDNFAVLKKALIDRGCTFRSSTDSEVVANLIGWYLDQPADDPDAFEEAVKRAVGELQGTWGLCVVHKD
HPDRLVLARNGSPLLVGSVGDQLFVASEPAALARHTNQYLMLKDGEIAVVTAQGVGQLEATRPVHRIAKETIELSPEPFA
HWTLKEIFEQPQALARAMNYGGRIAPYQNRVKLGGLDQNRESLLTVKSLLLCGCGTSLYAGIYGELLMQWLRCFDQVRAV
DASEVDIYHLPRQDAGVLLLSQSGETLDTVRACQLADFQGLKKFSVVNQVGSLLARMTNCGVYVNAGREVAVASTKAFTS
QVAVLSLIAAWFAQNQPTQAFPDRCSALMDAIHRLPVYAGMTLNCRALCQNIAERLKDAKTLFVLGKGFGYPVALEGALK
IKELAYLHAEGFPAGALKHGPFALIDEKEKTPVILVLLADQHAASLLNAAQQVKARGAHLICVTDEPDIVKDLADDVLVV
PSNGPLTALLACIPLQLLAYELAIAKGINPDKPRGLAKTVTVM

Gene-Specific Links for TGME49_031350

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins