ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_030420 ()

calcium-transporting ATPase, putative, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10158

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • PFA0310c calcium-transporting ATPase
  • PBANKA_020700 calcium-transporting ATPase, putative
  • PBANKA_061040 ATPase, putative
  • PY03970 ATPase, P-type, HAD superfamily, subfamily IC, putative
  • PY05776 calcium-translocating P-type ATPase, SERCA-type
  • PVX_081455 calcium-transporting ATPase, putative
  • PVX_084625 P-type ATPase4, putative
  • PCHAS_020540 calcium-transporting ATPase, putative
  • PCHAS_061210 ATPase, putative
  • PKH_020690 Sarcoplasmic and endoplasmic reticulum Ca-ATPase, putative
  • PKH_131080 P-type ATPase, putative
  • TGME49_030420 calcium-transporting ATPase, putative
  • NCLIV_030940 hypothetical protein
  • cgd7_4190 cation-transporting P-type ATpase with 11 or more transmembrane domains
  • Chro.70464 calcium-transporting ATPase 1, endoplasmic reticulum-type (calcium pump)
  • CMU_014320 calcium-translocating P-type ATPase, SERCA-type family protein
  • TP02_0524 calcium-transporting ATPase, putative
  • TA13655 calcium-transporting ATPase, putative
  • BBOV_II005700 calcium ATPase SERCA-like, putative
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_030420 calcium-transporting ATPase, putative
MDLSNEKAVGALSKHRASPNSESGTVSSSPDLLSSLQDVNIHTKAHVLDAEEVVRQLKADAKRGLSEADACERLELFGKN
ELEQEPGKSLLQLILEQFQDLLVRILLSAAVVSFILALFEGGADEGVTAFIEPLVILIILILNAAVGVWQESNAEKALEA
LKELQPAQGRVLRGGVWRLLPSANLVPGDIIDVRCGDKVPADCRVLALKSTTLRVEQSQLTGESVTVNKDAEVLAASYED
CEVQSKSNLLFSSTTVASGHAVAVVVATGMRTEIGKIQSAVQEAGADDEDQTPLQQKLDEFGEILSKVIFVICIVVWVIN
IKHFSDPVHGGFLRGCIYYFKIAVALAVAAIPEGLPAVITTCLALGTRKMAKKNAIVRKLASVETLGCTTVICSDKTGTL
TTNEMTCVRFCVPNMRHGTDEYTCEGSCYSPIGAVNYAGSSHSQRRKFHHIEETDQNLQWLARCATLCNEARLEIAPGSQ
GMKFTRLGEPTEAALLVLVEKLGCTDSTLNARFLQCEGRKEQAPMPFCDYWASSWNSLATLEFTRERKSMSVLCRERNSS
QNTLFVKGAPESVLERCTSVLLPNGTVTALTEGIRKKIQNDVDTMAADALRTLALAMKRDCGELADYDSASPSESRHPAR
KLLEDAANFAKIESDLIFLGLVGLMDPPRPEVSAAIDACRGAGIKVVMITGDNKLTAEAVASMIHIVDDGCVGNCSFTGK
EFEGLSLEEKKEVLSQDGVVFSRTEPKHKQMIIRLLRELGETTAMTGDGVNDAPALKQADIGVAMGIAGTEVAKEAADMV
LADDNFSTIVAAVEEGRSIYNNMKAFIRYLISSNIGEVASIFFTAALGVPEGLSPVQLLWVNLVTDGPPATALGFNPPDL
DVMKREPRHREDKLISNWIFLRYLLIGIYVGLSTVGIFVSWFVTGLDNGADPHTLVSLKQLMHWNECPSWEDFQVAPVYG
MKADDPCSFFTVGKVKASSLSLTVLVVIEMFNAFNALSEDASLLQLPPWTNPYLVVATVLSIAVHCCILYIPFLSRVFGV
VPLTAVDWVYVVVWSLPVIFIDEGLKAIGRMKEAARRRQLSLSRSQSQLRKLQ

Gene-Specific Links for TGME49_030420

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins