ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_030380 ()

protein translocation complex, SEC61 gamma subunit, putative, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_11314

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • PFB0450w secretory complex protein 61 gamma subunit
  • PBANKA_030690 Sec61-gamma subunit of protein translocation complex, putative
  • PY07642 protein translocase SEC61 complex gamma subunit, archaeal and eukaryotic, putative
  • PVX_003950 transport protein SEC61 gamma subunit, putative
  • PCHAS_030910 Sec61-gamma subunit of protein translocation complex, putative
  • PKH_041010 Sec61-gamma subunit of protein translocation, putative
  • TGME49_030380 protein translocation complex, SEC61 gamma subunit, putative
  • NCLIV_030910 LRRGT00025, related
  • cgd7_4210 Sec61-gamma subunit of protein translocation complex, putative
  • CMU_014340 protein translocation complex, SEC61 gamma subunit, putative
  • TA04175 protein translocation complex subunit (SEC61 gamma chain), putative
  • BBOV_IV002770 protein transport protein SEC61 gamma subunit, putative
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_030380 protein translocation complex, SEC61 gamma subunit, putative
MHERSVVFTPRAGCTYTRISLGVMTRERAQRLLCRLLDFFLGCAALSFVTSLLFASVSSWRRKLWSRSSVPQIVLLSVFS
LVPLSSSTMVNLNKVPAFLTDPNHPIGSLLLGLREFFFDSVRLVRRCTKPDAREFRKIAYACAIGFLLMGFIGYFIKLIF
IPINNILVGPPA

Gene-Specific Links for TGME49_030380

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins