ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_029990 ()

TCP-1/cpn60 family chaperonin, putative, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_11370

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • PF11_0331 TCP-1/cpn60 chaperonin family, putative
  • PBANKA_091620 TCP-1/cpn60 chaperonin family, putative
  • PY03629 t-complex protein 1, alpha subunit
  • PVX_092215 T-complex protein 1, alpha subunit, putative
  • PCHAS_092980 TCP-1/cpn60 chaperonin family, putative
  • PKH_093000 T-complex protein 1, alpha subunit, putative
  • TGME49_029990 TCP-1/cpn60 family chaperonin, putative
  • NCLIV_030660 TCP-1/cpn60 family chaperonin, putative
  • cgd2_600 t-complex protein 1, alpha subunit
  • Chro.20068 t-complex protein 1, alpha subunit
  • CMU_009790 T-complex protein 1, alpha subunit, putative
  • TA03225 T-complex polypeptide 1, putative
  • BBOV_I003340 t-complex protein 1, alpha subunit, putative
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_029990 TCP-1/cpn60 family chaperonin, putative
MALAIFGDRQSGQDVRTANAAAVQSIANILRSSLGPQGLDKMLVDDIGDMTITNDGATILKQLEVQHPAAKVLVELSDLQ
DKEVGDGTTSVVLLAAEFLRVGNQLVKEGVHPTAVIAGFKLAMKESVKFIQEHLTSRVDANNREVLMNVATTTISSKLIG
TETAHFADLVVRAILSVKMITERGDVKYPVSSINIIKTHGKSMRESSLVEGYALKAGRAAQGMPQCVKNAKVALLDFNLR
QHRMQLGVQIQVDNPEELEKIRQKEKDITAAKIQKILASGANVILTTQGIDDMAMKYFVEAGAIAVRRVDRKDLRRIAKI
TEGTVVLTMATLDGDEKFDASCLGTCEEVYEERIGDWDHLMFKGCKGGKAATVILRGANEYMLDEVDRSVHDALCAVSRA
LEYTHVCPGGGAVETSLSVYLENFARTLGSREQLAIAAFAEALLIIPKTLAVNAALDATELVARLRAVHAKAQGQLLDAA
GNGDEELKWHGLDLTSGKTRNNMAAGVIEAAVSKTKALRFATEAAVTILRIDDLIKIAPEPERGQQDD

Gene-Specific Links for TGME49_029990

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins