ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_029950 ()

26S protease regulatory subunit 6b, putative, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_11366

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • PFD0665c 26S proteasome AAA-ATPase subunit RPT3, putative
  • PBANKA_071560 26S proteasome AAA-ATPase subunit RPT3, putative
  • PY00544 26S proteasome ATPase
  • PVX_089640 26S protease regulatory subunit 6B homolog, putative
  • PCHAS_072470 26S proteasome AAA-ATPase subunit RPT3, putative
  • PKH_051730 26S proteasome AAA-ATPase subunit RPT3, putative
  • TGME49_029950 26S protease regulatory subunit 6b, putative
  • NCLIV_030650 26S protease regulatory subunit 6b, putative
  • cgd4_2540 26S proteasome regulatory subunit 26b like AAA ATpase
  • Chro.40284 26S proteasome AAA-ATPase subunit RPT3
  • CMU_017560 26S proteasome regulatory subunit 6b, putative
  • TA17225 26s protease regulatory subunit, putative
  • BBOV_II004930 26s proteasome aaa-ATPase subunit Rpt3, putative
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_029950 26S protease regulatory subunit 6b, putative
MSSAVVDHPAAEASLCPSDASGDSLHTRDLYAQLKALQKRLEFLNIQEEYIKDEQKNLKREFYRAREELKRIQSVPLVIG
QFMELINANEGIVASTAGSSYVVRILSTLNRELLKTGCSVALHRHSHSVVDILPPEADSTIQTLQMQEKPDVTYSDIGGM
DIQKQEIREAVELPLTCPELYQQIGIDPPTGVLLYGPPGTGKTMLAKAVANNTTATFIRVVGSEFVQKYLGEGPRMVRDV
FRLARENSPAIVFIDEVDAIATKRFDAQTGADREVQRILLELLNQMDGFDQTTTVKVIMATNRADTLDPALLRPGRLDRK
IEFPLPDRRQRRLIFQTITAKMNLSDEVDLEDYVSRPEKVSAADIAAICQEAGMQAVRKNRYVILPKDFEKGWKAHVRKH
ERDFDFYSF

Gene-Specific Links for TGME49_029950

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins