ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_029630 (IF2K-A)

protein kinase (incomplete catalytic triad), a gene from Toxoplasma gondii

Compiled localisation
endoplasmic reticulum and nuclear envelope during extracellular tachyzoite and intracellular tachyzoite

Who localised this protein by microscopy?

Narasimhan, J., Joyce, B. R., Naguleswaran, A., Smith, A. T., Livingston, M. R., Dixon, S. E., Coppens, I., Wek, R. C., Sullivan, W. J. Jr
Translation regulation by eukaryotic initiation factor-2 kinases in the development of latent cysts in Toxoplasma gondii. (2008 Jun 13, J Biol Chem) PubMed / full text
   more detail about this publication

endoplasmic reticulum and nuclear envelope during extracellular tachyzoite and intracellular tachyzoite
  • "About 76 and 13% of gold labeling for TgIF2K-A were specifically localized to cortical ER and the nuclear envelope, respectively. "
  • Microscopy type: Light and EM
  • Microscopy method: antibody directly to protein
  • Strain: RH and ME49
  • Gene model mapping comments: blast from AY518936.1
  • Localisation record: ER and nuclear envelope during free tachyzoite and invaded tachyzoite
  • Other genes localised in this publication: PIK3R4 kinase-related protein (incomplete catalytic triad)

Orthology

OrthoMCL

Part of OrthoMCL group OG4_20402

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>TGME49_029630 protein kinase (incomplete catalytic triad)
MVPWSHLGDAGFLSFSRKYQDASAPFPPRCATKQNRGFPPLVSRVSVRLRTPPRLQLAAQRATNLRLRDAASRPQFGFRR
DASCIVFYGEAKGQSARKKSRRTIPSQRYAQPQCCRCGSRRKLKFNGSQKPRQPLHRPRVALRFTSLSQRVRSESSARLL
SAYTRAGQLSFGISSLTACGAFCLSETQIEFDFVRPRLPFRVEGGSRSAHDTGFSALSSHLLEEPRDREILWENARVTPA
LRESLSAHLSACRAALTVSRRLFGSGRPASNPGDRHLKNIFLVDSRWLETAAATERREQRRCMSGWCERVGPSGADVGVS
SWTQHRDFEERRERRDETRRRLVASLSFPKFSSLLAGDAHARPLDSGALSKPNLFLQAFPFDSNGPQRPCGSRACWTSSL
PGREETGRTNWCLSAEALRECGGRGERPLFVFKRMSKRIRVPALAISPSLLAPPLAALLPAASPLFPFPAERPCGSASKA
GASTIPQTRVASSSVFSLDLSVDGTASAPVCKHFTPDCLSFCSLSARAPSAVCVLGARVRSVVRLFAGGTRARGELSETG
EGAPLERESVASGESNSRPKIEEVRHRRMTETRNDRGRSRPQPLRPAGVMPAVCTPSSDPLPVDGVPRLSSRFHFPTHSG
LSAARFAKETRDLHFSASPSPLDSSSSSSCSSALRRWKLSSPTQCTRSSRTAVRAGTGCFLLCLILLLVLLAKPAGELQD
PEIRWEGGEEPAPRCRVGPYRGSEDSAATEGERRLRFAFEESEGEGSLAETTTGPLISRGRRLGPRADCAVSVFESSPLA
SRDRKHVSVPHARTSSFQEITAIHHTAVSSSSAASSRGFSHSSARGETWRETWRRGEHAPATFADQFQDLRENEFNLKVK
LSMARSDDAGALARHRRMPPDRGGSRDRFPSFALYRGDRLLPFLRCSSHFRQYSPMLASSPFACGQARSRVSPKLQCRAK
EDHAAPERGPSVFSPPHRSQPRPMQPEIPPSTGDEGAGEAVSAVAPSSPHLCVFSHKDPSGLAPLSSWPETRSIAVPVPA
EAIAPPSANLPAPRVHADDSRAATFCTSSSSTANADCVSPGVSSLLARDAFSDSTLALVSPAGSTVRHRPCPGRARAVDR
GDTAGAGPAPVSVSPALGRKSRRPRLGKGQRRTDGLDSREQREASHQGRDTRDRSYTTRLSSPLTDRRRRPLRVPLPSHA
ASAPSVLAEDVGDRELFRVPHAVSVGASHSVSCRRAWRSGVGVTGGALPACQSRERSPEGEQCCGDNSRGEPRIPGRGSS
RHTSETRRKSPREASSKEAPGEHSEGRGVDSSSSSVSAPGAEAPQNTTQGFSDASREIGSNGSRDSLSEGDAGADMSNSF
SSLSPSSFVSSPSSPSHGDISSSSSLTAGSVARPFGSSLSRGSLPFSSRLAALVATAAAVAVRSSSPQAVHASAVSTPRS
DGVRDDEGPLSGAVADRELSRSSASLPPLPAESRAERDELQEPTRPRVSLVLGDARAQTATFVESRNGAEESAVVDREFV
PTSASLPLWPSAAVGREAETGDSPHSGWASSDQSSRLPSFRGETKGEEWSGERAADAERGSKAHALSTFRGQQPRESPFL
AGSLLLSAEAATLPEPHVGTHAEEESAEEERAVAGSGGVNDSIYSTSVEHQAKGLAFPQPPTDHETPSPVSASATSNKQA
DMVSPTSSLPSSLAISAAVPLFARDEGHESPREGVSGGGGRDSGVHSGVSETPRIAAEDADASDLLASTSGVSLSSSPPI
ARFAAASSSSIVPHQVASSAGSLGRGETGGLASEASESRLSSHGPSSLLEERERGRQREGDARAGLQSLIVLSITGDLYH
VTTNGSFVWQRSLGSSLATAFDLEPETSSSEDEPRRASTGPKKPRGDAEPRRSPKSPEAPGAQGPPRAAARVEDRGTSEL
AQTGLGRRLLPAHDGSLFFLDDDGSLTALHVSIPEVVNHLPFQAPLFPHVYFTGEREVRVTALDLETGQPIAGHRRRGRA
RGKGLRAKSSRQGARDRRTRRPRAPLAREPKRHGDSGGDRGGVEEEAGSREEVQILEDGSRRVRRDESREKPFVFESLSL
APRPEDVQENQETAETISGEDDSEEETDEPRQLQFGVTVWKLWAVDNKAHTTQWGLKWVEVDALGSLTSPGAAPSSRVAY
LRNILRVDDDKLYLLPSPSFSSSPLGRVETRDGGDEGPATEGPGDPFPAQPSSERLTRLRSSRASPASFAPSFAPFTSTS
PSQNTAPLFLKFPAPIAAVYVVGPPDGEGETEEPARRGDREDGRSVLGTSRLVLLSDHEEDGSGDQEVSSDPIRPWGEGT
TTRGTAGEPSRMDETGRRLRDPAKNRRRKGGPGPLVTLECIVRQWGEGAAAIPFAYVPSSQHAVRGDREAFPAFAPFAFP
SQNAHSYASLLLPSMRRLGGSPGPALAPAPPRLPGHSGRRPAGTYPGDEPFDSLVWRDREVALPAPPGPNYLEDLKRPLG
EEAHADDSLRDAHDKAGRDSRPHSLLPAPLDFLPTSSVSSSLVPTDDRSPLSASFSASSLPSSHSSFSASHASFPSSSLS
LSSTPSPAHAPGSQRVLSPYALHNFRAPAPVQPVRLSHPEAFASQVTLWSGWESPEFPLDSRMQSFPSGREKTVRSGALR
EPSGGFDAEDGDREENRETADKMARGVAPREGDETRKERARGKETPETDASVGDGARHALNVPQLELSEKEGRALTPGGG
TGAAVDEVGTRASPLYGVPPSQLPALYGAFDAAPLSFNPVLSPVLSVLRRWVGRLTRPSARFFLLPLLSPEPDEERGSSA
ARPDDLLAGKARRHEGADRATVCGVEDREARSSALFFPSSSLNSFSPSSPSWLTPHAQAPPNYVVSLRPDSRRGDRRACG
AEGRRASSENGPEPEASPEPGRSWLAPGAWAADLLAPSWAARLLFLLAAASSMFVVFRFRGLVSGLLAGVLGFLVSLAGH
PWRPCARVLFLLLPPPLRPRAPLAEDGRDGEEREDATDLLVRPIELQGACTLLSAEEGASPGHLRAGRRPSEVEERPGSG
VVEDGAVSPHASGGQLALEAWSGASEVVALPRPLSSPVWATPRTFATPARSLDFDAFAASSLDATQNTNDGGSALSPTAR
ALQARDARGGRDASWAVPGKTGLRPPDGASSHGTLSAIAWTGRGGTSREEIQRDQDARGQTGAVAWGTETAPSAPADVAE
DMRRLVLALESRARKREGLTAEGRESRADSGNRTPMYSCRTASSVSMVSEDESDRRPQLEALGDLSSCREFAAEMGTDVQ
TPGEEASPRQGLAKSQWGDRGAGRQMRAEELRLSELRARRKVDFPLVQTVGPPLALPGQGDIRFYRRGSSLAAVSSGGSV
CSSSSFATAPNARGSRRSPAPPLAPGACDPFGRHAGETATEEGVSVASVLDLRCGEERAAAESPFSLVSSRSTGERMRRA
RAPSSPMELIGERMQSSPFLEAIRSARAFADEASILPPPLVAASAGLPGPLPIVAPDSPDACCAGEEIGFIGAAAPGAGG
GGMAFGGGRGRPAEPWEVRGRGGGEGQARPGDDTHDGIVGGGEGLPEGEKRQTERETVTPIYLPGGRMGGGYAGEMFSAE
EWQRVMFRRAGRRCNSVGQLTVYGGGHEASRGSTAHARWGMPKPLPPVLPPGVCAEAGATPQSDVLPVRPGPVSPRPQTA
DERKCGGDSGGSSGGRGTAMGLADPNGGVQPLIGDVDSASASSPSVRAASSQAVASRLLPSGIHEVKQETVAVSLPSRGD
SDEGATPESRFLTDGVSPSPIATHPASTLPLGGGLSLAPDEARGSLAHGDALKALEALSGVTTAYVGSASGSVGDSANSA
SGAVLKVVNSEVAGVLDPSGLVLTSAARLLMAVGGGHATVEEGGTEQREAGLAGQEVHLAGAARPGDGLAKSTTHGGGVE
GGETEKGPLEVAADGGEGSAAALPPPAAPPVEGGGATGAIVRAGLNVPEVAVVAPPVSPVPAKVDRGIPPDSSLAKLLEN
GRFERTFAIQKLVGQGGFGVVYQVRHLLEPGHPIYAVKLILLRLTLSEDISLRRDFREVAANRDLYSKHVVRYYTWWCEE
PRFLPVESLGGSRGALTDRRGVGSSAVRDSGPRASVGVTTLTMSPGCLDSARGSSRFWMESREAQKNLRRTIRDSAVCKS
RREDLSSSFLAVYRQREECRRQTSGREATGGRGLAGNASGLWRRQPARRRSLSEASCASTSTRRCDTAEREELLAKSQTS
HLSSEAKRDETLRGTLQRRRRSSFPVESASQRRQDGRETLPAEFLEFSLRSAKDARSQSRNTRSASADSFSPTKKPERRR
RSSLPLSLSCGSRSREEHRQLERRRPRATSRYPSRYAGRERGRSRTDEGWKAEKKLRKSARGRRGSESSYTSEKTDLRSW
CPRCEKQRSVRPHSFPTAKRRAFSIPALKERQEEREEEAFPSWFFEQDEDSFLSRGMRIEESNDHTARARAHRLLCCSGD
SFSDAECTYTNGGSGAFWGAGAEAPRSLQVSGGCTCRWTSGEETEGPREASGRGDPPGRGATKRGERRLSRGGEASELRP
AEARQKTQARKKGKLRAQEWSGPDVSFDMNCYLNTQERDMVVFEDENSGESNRASSRRSREDADSSRSTALNGQGRERFS
VDEEARREKDKNAEDSRRRGRTRRDLLEAIRPAELAREKRNGLQPPAKETLYPVVLLIQMEMCNGVTLREWLDRKDRSTV
AMGFVPSSKNRWHSMELELFKQLMKGIRDIHERGIVHRDLKPENIFVDPDTLVLKIVDFGLAKFIQRENPSGAAAGGAPG
GLEPGGPGGADGLDLGERNREKQRQKIKGLLAKARRMGKNMEMSYKGEVIGTPAYAAPEGGGLCDEKADIYSSALILLEL
LCPRFTTVMERVKTLEDFKTSYSVPQHIRLHLHPWYLLMKEMARPEPQHRPSAYTVLKHVKMLLTPPGDTQPQRVMLLYP
EPGSPQLDASASPSGALGPLLSSSPALEPSAFPAEPSFPAPIGSTSPFSSSSSSLGAAETLSFALDDGASSVAAEECDEA
EKPSAESPGVETLGDRAYGMRVRQGKGKNERD

Gene-Specific Links for TGME49_029630

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins