ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_029480 ()

membrane-associated calcum-binding protein, related, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_13205

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • PBANKA_093840 endoplasmic reticulum-resident calcium binding protein, putative
  • PY05050 membrane-associated calcum-binding protein
  • PVX_091105 membrane-associated calcum-binding protein, putative
  • PCHAS_090590 endoplasmic reticulum-resident calcium binding protein, putative
  • PKH_090580 endoplasmic reticulum-resident calcium binding protein, putative
  • TGME49_029480 membrane-associated calcum-binding protein, related
  • NCLIV_030420 Rcn2-prov protein, related
  • cgd2_3990 protein with signal peptide, ER retention motif and 4x EF hands
  • Chro.20427 membrane-associated calcum-binding protein
  • CMU_002970 EF hand domain-containing protein
  • BBOV_III007520 membrane-associated calcum-binding protein, putative
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_029480 membrane-associated calcum-binding protein, related
MAAFADRPTCRVSLGAVFLARELHRLRKSLPLCVFSLFLFSFAFSALSGAPSQFAEAAMPKLSGEKLAELMQMDVKDIKE
RMLALFDLIDTNQDNTIDTEEAKEWSAKLKNAMHQHQVRMEFQAIDKDNDGKVSLSELEATYVDSLDQKQLEQHKKEVEQ
RFKTVDKDNDGLLDLSEIRILMDPGKDEGLMKIEIEEILNAQDKNGDRKITVTEFIETEGTGSLNDVEKTELEKEFKSYD
LNADGAIDVEELQQIIKDPHSHEIRMLLEEFTKDLKDGKVGREQWEKEFESFAVSMLTDNGEVLRFPEDYSGIEFPFKTA
VPQVDLDDEDKHDEL

Gene-Specific Links for TGME49_029480

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins