ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_029010 (RON4)

hypothetical protein, a gene from Toxoplasma gondii

Compiled localisation
moving junction during extracellular tachyzoite and intracellular tachyzoite and tachyzoite invasion
rhoptry neck during intracellular tachyzoite and tachyzoite invasion and tachyzoite
cytosolic side of host cell membrane and not rhoptry body and parasitophorous vacuole during tachyzoite

Who localised this protein by microscopy?

Straub, K. W., Peng, E. D., Hajagos, B. E., Tyler, J. S., Bradley, P. J.
The moving junction protein RON8 facilitates firm attachment and host cell invasion in Toxoplasma gondii. (2011 Mar, PLoS Pathog) PubMed / full text
   more detail about this publication

rhoptry neck during intracellular tachyzoite
  • "RON4 is used for colocalization to the rhoptry necks for each strain."
  • Microscopy type: fixed light
  • Microscopy method: antibody, HA tag
  • Strain: RH ku80- hpt-
  • Gene model mapping comments: inferred from another publication
  • Localisation record: rhoptry neck during intracellular tachyzoite
  • Other genes localised in this publication: hypothetical protein, hypothetical protein

Daher, W., Plattner, F., Carlier, M. F., Soldati-Favre, D.
Concerted action of two formins in gliding motility and host cell invasion by Toxoplasma gondii. (2010, PLoS Pathog) PubMed / full text
   more detail about this publication

moving junction during extracellular tachyzoite and intracellular tachyzoite

Gonzalez, V., Combe, A., David, V., Malmquist, N. A., Delorme, V., Leroy, C., Blazquez, S., Menard, R., Tardieux, I.
Host cell entry by apicomplexa parasites requires actin polymerization in the host cell. (2009 Mar 19, Cell Host Microbe) PubMed / full text
   more detail about this publication

moving junction during tachyzoite invasion
  • "Tachyzoites were labeled with anti-P30 antibodies under nonpermeabilizing conditions (A–D) or with anti-Ron4 antibodies to stain the MJ (E and F; see white arrows)."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: RH
  • Gene model mapping comments: inferred from another publication
  • Localisation record: MJ during tachyzoite invasion
  • Other genes localised in this publication: SRS29B (= SAG1, P30)

Besteiro, S., Michelin, A., Poncet, J., Dubremetz, J. F., Lebrun, M.
Export of a Toxoplasma gondii rhoptry neck protein complex at the host cell membrane to form the moving junction during invasion. (2009 Feb, PLoS Pathog) PubMed / full text
   more detail about this publication

moving junction during tachyzoite invasion, cytosolic side of host cell membrane and rhoptry neck during tachyzoite
  • "RON2, RON4, RON5, and RON8 are all present at the MJ during invasion... we demonstrate that RONs are exported to the host cell membrane, RON/4/5/8 being exposed to the host cell cytosol and RON2 being probably an integral membrane protein that displays a privileged interaction with AMA1."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: RH HXGPRT–
  • Gene model mapping comments: inferred from another publication
  • Localisation record: moving junction during tachyzoite invasion, rhoptry neck during tachyzoite, cytosolic side of host cell membrane during tachyzoite
  • Other genes localised in this publication: hypothetical protein, rhoptry neck protein 2, hypothetical protein, SRS29B (= SAG1, P30), dense granule protein 5 precursor

Bradley, P. J., Ward, C., Cheng, S. J., Alexander, D. L., Coller, S., Coombs, G. H., Dunn, J. D., Ferguson, D. J., Sanderson, S. J., Wastling, J. M., Boothroyd, J. C.
Proteomic analysis of rhoptry organelles reveals many novel constituents for host-parasite interactions in Toxoplasma gondii. (2005 Oct 7, J Biol Chem) PubMed / full text
   more detail about this publication

parasitophorous vacuole and rhoptry neck and not rhoptry body during tachyzoite

Alexander, D. L., Mital, J., Ward, G. E., Bradley, P., Boothroyd, J. C.
Identification of the moving junction complex of Toxoplasma gondii: a collaboration between distinct secretory organelles. (2005 Oct, PLoS Pathog) PubMed / full text
   more detail about this publication

rhoptry neck during intracellular tachyzoite and tachyzoite invasion
  • "Using intracellular parasites, and as predicted from the literature, anti-RON4 and anti-TgAMA1 antibodies gave the closely apposed but clearly distinct IIF patterns typical of rhoptry necks and micronemes, respectively"
  • Microscopy type: Light
  • Microscopy method: antibody directly to protein
  • Strain: RH hxgprt-
  • Gene model mapping comments: inferred from another publication
  • Localisation record: rhoptry neck during tachyzoite invasion and intracellular tachyzoite
  • Other genes localised in this publication: -

Lebrun, M., Michelin, A., El Hajj, H., Poncet, J., Bradley, P. J., Vial, H., Dubremetz, J. F.
The rhoptry neck protein RON4 re-localizes at the moving junction during Toxoplasma gondii invasion. (2005 Dec, Cell Microbiol) PubMed / full text
   more detail about this publication

moving junction during tachyzoite invasion
  • "demonstrating that the moving junction protein was the rhoptry neck protein RON4."
  • Microscopy type: Light
  • Microscopy method: Monoclonal antibody directly to protein
  • Strain: RH
  • Gene model mapping comments: Blast from SEEDSEAAETPTPLR
  • Localisation record: moving junction during tachyzoite invasion
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_115012

Localised Genes in this Group
Other Apicomplexan Genes in this Group
    There are no other apicomplexan genes.
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>TGME49_029010 hypothetical protein
MAIKNTLTGSGLLVLLTLACGTTVQSSPPTPAPRMYPNMNERPLSAESRLTPGTYRSELHIDLKSPQKTASQSSLAPTGD
NNSKVESIIAGSDTTPRSAEGTSESPPVPQLGTPPRPAPRRSKGEGERQPPTAAPRTSRSVDTGSGSDASTEQQAGGQKV
VTPIPASKGIYPSLDELRRSQESNVDAGSGTSTNEGGGTSEGPQVPQSGIPPRTGRRRAKARNRKRHPTPASRESSSEDE
NQPPTTASRPSNGEGESQPPTAAPRTSRSVDTGSGSDASTEQQAGGQKVVTPIPASKGIYPNLDELRQTQEGEESAPQPA
DVTWFSMSVPMGVVDRRVSRALKEQFFQFLQHLSADYPKQVQTVYEFLGWVADKLPENEEEVQMFIDALNTTEAMVGKAA
RWIFKAIPERERETIYSSFYQMFRDKLPKKFFETAEGMNPDVGQYFSAEEPVAVTPEIPAKSEEDSEAAETPTPLRRQAN
VAAQVLHPLPAKGVTRREWIPWPKMQNAISKAHGPLTRVPEWTPVTGSCALGDGYTDIDVTKATTDVLFRITLLILQQIR
RKKTERGKLEDDQALVALCSAAGAFVDAWQHQQQALILEDPGTPKAHAQLIERLRNAGKYFMKSYDETTGESDHQQWKKN
KAEVSKLGKSALMKSCVKYIKASGDVATRPFDSGTAKYPSRSLYGGIANTLETPFADSEAVAKAVHDYAKEHKKPEKLVG
LCGALQISGYFKKCFSDAGRLSSVSFFHQHVDGASVLVRTLARERPIGRHALSQAICDPNISAQYFEGAFRLFSSTVSQE
WEKENLFAQLASWTGKEMVLAPSLEEQAAVPPAQPAYETVYGDEEDRIYRIHVSGRHSSPQEVLYVGGIPSTVKPQQVHV
LGPTVSDESRRVIHPVRHRSRTAPSSEAASAAAESSDEDPLPAENATAFLGVTPQEEESDAYKHTLDFDAVSPRKNKNKE
NRISAPLKQSDTLIEESTSKTSEL

Gene-Specific Links for TGME49_029010

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins