ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_028420 ()

AGC kinase, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10280

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • PFI1685w cAMP-dependent protein kinase catalytic subunit
  • PBANKA_083560 cAMP-dependent protein kinase catalytic subunit
  • PY05235 Protein kinase domain, putative
  • PVX_086975 cAMP-dependent protein kinase catalytic subunit, putative
  • PCHAS_083590 cAMP-dependent protein kinase catalytic subunit, putative
  • PKH_073290 cAMP-dependent protein kinase catalytic subunit, putative
  • TGME49_026030 AGC kinase
  • TGME49_028420 AGC kinase
  • TGME49_086470 AGC kinase
  • NCLIV_014140 AGC kinase, putative
  • NCLIV_046800 AGC kinase, putative
  • cgd3_3040 protein kinase, cAMP-dependent, catalytic chain
  • Chro.30344 protein kinase (EC 2.7.1.37), cAMP-dependent, catalytic chain
  • CMU_000350 protein kinase, cAMP-dependent, catalytic chain, putative
  • TP02_0378 cAMP-dependent protein kinase, putative
  • TP02_0727 cAMP-dependent protein kinase catalytic subunit, putative
  • TA12860 cAMP-dependent protein kinase catalytic subunit, putative
  • TA14790 camp-dependent protein kinase, beta-catalytic subunit, putative
  • BBOV_III005740 protein kinase domain containing protein
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_028420 AGC kinase
MQKPLLPPGTGKEAFEFGPTLGTGSFGRVKSAKYLKSTSTNVDDPTQVPPRVAVKLLKKAAIIKLKHVDHIINEKKILLA
LDHPLTVRCFGSFQDSRYLYLVMELVPGGEFFTHLRKAKRFDNDTARFYAAQIVDIFDYLHSQNIIYRDLKPENMLLDKD
GYVKLTDFGFAKVVEFRTDTLCGTPEYIAPEVLLNKGHGKPVDWWTLGILIYEMMVGYPPFLDDDPLGIYQKILAGKFVF
PKFFDKDAKVLVKKLLQADLSKRWGNLKNGVRDIKECRWFCTVVFEDLRAKKVVARYKPTVKGMDDLSNFEAYPDEKDDA
VPVDPMKDPFTTW

Gene-Specific Links for TGME49_028420

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins