ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_028210 ()

26S proteasome regulatory ATPase subunit, putative, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_11246

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • PF13_0033 26S proteasome regulatory subunit, putative
  • PY02590 26s protease regulatory subunit s10b (p44) (conserved atpase domain protein 44). [thirteen-lined ground squirrel]
  • PVX_122155 26S proteasome regulatory subunit, putative
  • PCHAS_140680 26S proteasome regulatory subunit, putative
  • PKH_140490 26S proteasome regulatory subunit, putative
  • TGME49_028210 26S proteasome regulatory ATPase subunit, putative
  • NCLIV_045220 hypothetical protein
  • cgd8_840 26S proteasome regulatory subunit S10b like AAA+ ATpase
  • Chro.80103 26S proteasome regulatory subunit
  • CMU_024750 26S proteasome regulatory subunit S10B, putative
  • TA09310 26S proteasome ATPase subunit, putative
  • BBOV_II003900 26S proteasome AAA-ATPase subunit RPT4a, putative
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_028210 26S proteasome regulatory ATPase subunit, putative
MVTSTAQPGGGDDERARALQAYVAKVKEHRECEAKVKKLREEVKKQSGRYEKTEDDLKALQGVGQLIGEVLKQLDSEKFI
VKMSSGPRYMVGSKPKIDKASLTAGTRVALDMTTLTVMRKLQREVDPLVFNMLHEDPGSVQYGEVGGLSEQIRQMREVIE
LPLTNPELFKRVGIKTPKGVLLYGPPGTGKTLLARAMASNMNCNFMKVVASAIVDKYIGESARVIREMFAYARDHEPCII
FMDEIDAIGGRRFSQGTSADREIQRTLMELLNQLDGFDELGAVKIIMATNRPDVLDPALMRPGRLDRKIEIPLPNETARV
DILKIHSSKIAKQGDIDYEAICKLCDGFNGADLRNVCTEAGMFAIRAERDYVVEEDFFKAARKLADNKKLESTIDYDF

Gene-Specific Links for TGME49_028210

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins