ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_028190 ()

eukaryotic translation initiation factor 3 subunit 5, putative, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_12513

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • PFI0895c eukaryotic translation initiation factor 3 subunit 5, putative
  • PBANKA_081930 eukaryotic translation initiation factor 3 subunit 5, putative
  • PY02659 no apparent S. cerevisiae ortholog, putative
  • PVX_099335 eukaryotic translation initiation factor 3 subunit 5, putative
  • PCHAS_081960 eukaryotic translation initiation factor 3 subunit 5, putative
  • PKH_071560 hypothetical protein, conserved in Apicomplexan species
  • TGME49_028190 eukaryotic translation initiation factor 3 subunit 5, putative
  • NCLIV_045240 eukaryotic translation initiation factor 3 subunit 5, putative
  • cgd7_1080 eIF3-p47 with JAB/PAD domain
  • Chro.70132 hypothetical protein
  • CMU_033050 Mov34/MPN/PAD-1 family protein
  • TA08465 hypothetical protein, conserved
  • BBOV_II001460 mov34/MPN/PAD-1 family protein
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_028190 eukaryotic translation initiation factor 3 subunit 5, putative
MIRSVSRSVGTSSQQHNVPKHFDILPYPPLKVRVHPVVVLTILDAYLRREEGQMNVIGTLLGTVSEGNVVDISDCFVDRH
SLTDEGLLQIIKDHHETMYELKQQVSGSGTKDIVVGWFCTGSEMTELTCAVHGWFKQFNSVSKFHPQPPLTEPIHLMVNT
TMDRDNLSIKAYMQVPMNMAKDACFQFQELPLELFASSSDRAGLSLLLKVREANRRHRQQHDGSRASALSSSSTSSAAAV
AAISDTPGVAGVPVIKQGLGAALEKLSDQLNKCGAYVRSVLDGSEKADPEIGRFLSKALCVEAVQDLEVFEQMCQNALQD
NLMVVHLTSLARLQFAVAEKLNTSFF

Gene-Specific Links for TGME49_028190

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins