ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_028180 ()

cytochrome C oxidase assembly factor COX15, putative, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_11985

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • PF14_0331 cytochrome c oxidase assembly protein, putative
  • PBANKA_100980 cytochrome c oxidase assembly protein, putative
  • PY02555 cytochrome c oxidase assembly protein
  • PVX_084785 cytochrome c oxidase assembly protein, putative
  • PCHAS_101070 cytochrome c oxidase assembly protein, putative
  • PKH_131430 cytochrome c oxidase assembly protein, putative
  • TGME49_028180 cytochrome C oxidase assembly factor COX15, putative
  • NCLIV_045250 cytochrome C oxidase assembly factor COX15, putative
  • TA18480 cox15 homolog, putative
  • BBOV_III002290 cytochrome c oxidase assembly protein, putative
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_028180 cytochrome C oxidase assembly factor COX15, putative
METQQAATPSLTGRLSQGLAGCSGLIFGLVCWGGYTRLTRSGLSMTDWRFQGKKLPQTPEEWEVEFNRYKETPEYQQVHH
GITLEEFQQIYFIEWFHRMFARATGLFFVGGTFGFAAAKALTSRMTLRLAGMGILGAAQGLVGWWMVKSGFSEPTTENKM
PRVSPYRLAFHLVNAMALYSLVLWHALSLLYPATSAIAVAAAPTVGMAAVRAAMNKLRSRTWALGALIATTLCSGAFVAG
NDAGHAYNTWPKMIDDWVPPEVYEVVKQPLKIFESTPVVQFDHRMLAYATLIGSSLLYFTGRRLPVPTEVKVALAALPSM
VTLQLLLGITTLLFFVPTELGVLHQGGGMATLSALVYLCHTISRVSRSLPV

Gene-Specific Links for TGME49_028180

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins