ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_028170 (IMC2)

serine/threonine protein phosphatase, putative, a gene from Toxoplasma gondii

Compiled localisation
inner membrane complex during tachyzoite

Who localised this protein by microscopy?

Mann, T., Beckers, C.
Characterization of the subpellicular network, a filamentous membrane skeletal component in the parasite Toxoplasma gondii. (2001 Jul, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

inner membrane complex during tachyzoite
  • "TgIMC1 and TgIMC2 are localized to the subpellicular network of Toxoplasma"
  • Microscopy type: Light, EM
  • Microscopy method: Monoclonal antibody directly to protein
  • Strain: RH hxgprt-
  • Gene model mapping comments: Blast from AY032682.3, annotation inconsistent?
  • Localisation record: inner membrane complex during tachyzoite
  • Other genes localised in this publication: membrane skeletal protein IMC1

Orthology

OrthoMCL

Part of OrthoMCL group OG4_27941

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>TGME49_028170 serine/threonine protein phosphatase, putative
MERRTRPDVSPRWQARRIHFVWLTALAVPIFLLFPSLSLLESTSSAGCSGIQCFASFPGVAAGSTHSREGADPSPQETLM
QPRRLSGIIKTLVLWDPVQRLMPSLNLDSVVFVAGKHKADRSAAFHTTMDDVMTLLLRWFNEKDKPNWLLQGFVTEAALF
REHVRYQDQMIHEQTQNQSEQQPTDPQAGMDKVLNIEVYTYLAGAKRRVRDWICDGNTFMRTGEEGSHAFKQPFLTERDV
GFLRGLPYNVLRVARGVYSKRVPASVKRLQEELFHRGIRTLNDLLLKTNLMDLFVLFDIMDESFTQIDVLREFSNRWKKY
RAEEVVPPLLPPGKWEGERSIEELMRDDHYPSMKFPRCTMLKCVMQDTWSKNAVETITVEKKDTNSLKLLLIGNTGIGEY
KSRAERKGLWYKLKRFLWTNEFDQTVSALAKWHAEEKADAVLGLGDFLGIPGPLSARDERFTKRWYDIFVKDAKLDIPWL
MTLGEEEALVNPSASVRHHYTGEHPNWYMPNDAYTATFSFSTSMTMANGTIQHEAFNATVINVNTWNLFVGNPIANNMQS
MMDRLMWLSDQLYTAVNQTTNWLIIMGHLPLVSTGPQGEQGRLQYVDDLYKNGQPRGPEAVLIQMLLSHYQVDLYVSAHD
HFMEYVALEDLSKNTTTAFITSGAAVRLLDKDVGRGWIGRLRGALYPILCWSGRRILYAFHPGGCHPERWDQNQAYRFFA
PVNSQYKVNIVERVTKATGFAALRLTKDYLVAEFIDSRSKKLAGRRASKRSNKDQRDIQFMDPVAEGRLRYDELEAARSA
FADANEERISKEIQFARQCPILAQRIKFYQTEINDLVSKYDQIGKQKDAYEVMDDNTIEILLSEGVNVVSRIAQAVSEMN
VLAGDYDKMVKKYRELIDLKDTMPAADDPRYAQLFQLEKAYIDARKMRQQTARELAVGRDGMQDREGEKDLERMILNMQV
IRREIVAVENDIKANPFVPSEEQPEEGKVDVNGAETPEGGDGKEPLPAIKYPDDSLEARIERKREQLQKHERSLSALKRA
SPEDREKIKMRIVELERLIKGTQEELAAMQQRLQRQQQAMRPSRVWQLLQRRQDLETKLLQIKILVNQVEKLPEETRTSP
DARAQVERLTAQRVNIEKDIRDISDELGTREPTELEKQCLDKKASVWRAELVLAQESLLSEKQRSIPVVRDAVHAAKRSI
GGLRRELEELTEKVKVELRERDAAFDAGLEASRVPPPEAEGRKVTPVPAPHVQANLETQGRSRADALMHEFNGGEDEIAV
IDEAIRVSPLLSPEERAELEKLVGPVQDLPQKKADLEKRLAALKDQAEQEAQEANVDPEAKRAGSGSRRLFELFEPKKEP
TPYKQLEPIDLGPVDSCLQVPMLEYHVEIALHPTMQKYIKDKCIFIFAQMAYQTQYRVIQPVHLYLRSHKGLQTLLYRVP
SVHVFRAWNQFFGSMHNTRFKSLLKTLKKGLKFVHETFKPVGARGEALEAS

Gene-Specific Links for TGME49_028170

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins