ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_027810 (ROP11)

Rhoptry kinase family protein ROP11 (incomplete catalytic triad), a gene from Toxoplasma gondii

Compiled localisation
rhoptry during tachyzoite

Who localised this protein by microscopy?

Bradley, P. J., Ward, C., Cheng, S. J., Alexander, D. L., Coller, S., Coombs, G. H., Dunn, J. D., Ferguson, D. J., Sanderson, S. J., Wastling, J. M., Boothroyd, J. C.
Proteomic analysis of rhoptry organelles reveals many novel constituents for host-parasite interactions in Toxoplasma gondii. (2005 Oct 7, J Biol Chem) PubMed / full text
   more detail about this publication

rhoptry during tachyzoite

Orthology

OrthoMCL

This gene does not have an OrthoMCL group.

Amino Acid Sequence

>TGME49_027810 Rhoptry kinase family protein ROP11 (incomplete catalytic triad)
MSSSRLVLVSKMVDSCARLACFCIGLFFCLAVWQHQAGHAYSATHHHAVNSDNKSFNDSAPHWTLNQVLRDGTVQSESPS
YLQHSSLPSNISPALELAALGQDPVRRRPQPVQVARTGTTTTGRVQLGRQVARVTPEELATMVEPSLKDLLNRSTLPQTP
FVIETLRVFATPEGDTSLPYTMERILGAGAASIVIQAVQETVPQEPARRRRSWFSRLRKSHAPADTRPRVALRFPVVDVR
KKQQELPEVPEAELLSQLAEEQLRLEIHKVALVSSAAGTEGNFDSEWGFALPFRVGRLSNEGLVLAMDGSGKAILNFVTV
SPAMMCDLHTLRSSSRTPAMDEFVVMRVLQLAANLERLQLTHLDITDENVLVGRDGQLFLGGFQHVRAKDGGISCGKIPS
VTFTDPRLAHCAVNNPGSYAAVNPAVDAWMAGMMLLRWFCGDVFFNRRSSLAEPRQAVQVLAQLQADFIAANDYMVSFPA
FTQWDRCRHHVNERFQFIIQSLLDVNPYKRGAPSAQLTAYFPVTG

Gene-Specific Links for TGME49_027810

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins