ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_027620 (GRA2)

28 kDa antigen, a gene from Toxoplasma gondii

Compiled localisation
dense granule during extracellular tachyzoite and intracellular tachyzoite and tachyzoite
not parasitophorous vacuole during sporozoite parasitophorous vacuole 1
during not bradyzoite and not merozoite and not sporozoite
parasitophorous vacuole during bradyzoite and tachyzoite
oocyst wall during tachyzoite
not oocyst wall during bradyzoite

Who localised this protein by microscopy?

Rooney, P. J., Ayong, L., Tobin, C. M., Moreno, S. N., Knoll, L. J.
TgVTC2 is involved in polyphosphate accumulation in Toxoplasma gondii. (2011 Apr, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

dense granule during intracellular tachyzoite

Ferguson, D. J.
Use of molecular and ultrastructural markers to evaluate stage conversion of Toxoplasma gondii in both the intermediate and definitive host. (2004 Mar 9, Int J Parasitol) PubMed / full text
   more detail about this publication

parasitophorous vacuole during bradyzoite and tachyzoite, not oocyst wall during bradyzoite, during not merozoite

Luo, S., Vieira, M., Graves, J., Zhong, L., Moreno, S. N.
A plasma membrane-type Ca(2+)-ATPase co-localizes with a vacuolar H(+)-pyrophosphatase to acidocalcisomes of Toxoplasma gondii. (2001 Jan 15, EMBO J) PubMed / full text
   more detail about this publication

dense granule during tachyzoite
  • "Co-localization studies with the antibody against the V-H+-PPase and an antibody against the dense granule marker GRA2 (Labruyere et al., 1999) were also performed to rule out that the organelles identifed as acidocalcisomes were the dense granules."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: ME49
  • Gene model mapping comments: inferred from another publication
  • Localisation record: dense granule during tachyzoite
  • Other genes localised in this publication: Ca2+-ATPase, H+-translocating inorganic pyrophosphatase TVP, putative

Labruyere, E., Lingnau, M., Mercier, C., Sibley, L. D.
Differential membrane targeting of the secretory proteins GRA4 and GRA6 within the parasitophorous vacuole formed by Toxoplasma gondii. (1999 Aug 20, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

dense granule during extracellular tachyzoite
  • "GRA2, GRA4 and GRA6 are colocalized in dense granules"
  • Microscopy type: EM
  • Microscopy method: Monoclonal antibody directly to protein
  • Strain: RH
  • Gene model mapping comments: inferred from another publication
  • Localisation record: dense granule during extracellular tachyzoite
  • Other genes localised in this publication: hypothetical protein, granule antigen protein GRA6

Ferguson, D. J., Cesbron-Delauw, M. F., Dubremetz, J. F., Sibley, L. D., Joiner, K. A., Wright, S.
The expression and distribution of dense granule proteins in the enteric (Coccidian) forms of Toxoplasma gondii in the small intestine of the cat. (1999 Mar, Exp Parasitol) PubMed / full text
   more detail about this publication

during not bradyzoite and not merozoite and not sporozoite, dense granule and oocyst wall and parasitophorous vacuole during tachyzoite

Tilley, M., Fichera, M. E., Jerome, M. E., Roos, D. S., White, M. W.
Toxoplasma gondii sporozoites form a transient parasitophorous vacuole that is impermeable and contains only a subset of dense-granule proteins. (1997 Nov, Infect Immun) PubMed / full text
   more detail about this publication

not parasitophorous vacuole during sporozoite parasitophorous vacuole 1
  • "While sporozoites inhabited the distinctive PV1, the staining of anti-GRA1, -GRA2, and -GRA4 antibodies was confined to dense granules within the sporozoite cytoplasm and no staining was observed outside of the parasite itself"
  • Microscopy type: Light
  • Microscopy method: antibody directly to protein
  • Strain: VEG
  • Gene model mapping comments: inferred from another publication
  • Localisation record: not PV during sporozoite parasitophorous vacuole 1
  • Other genes localised in this publication: dense granule protein 1 / major antigenp24, hypothetical protein, dense granule protein 5 precursor, nucleoside-triphosphatase I

Achbarou, A., Mercereau-Puijalon, O., Sadak, A., Fortier, B., Leriche, M. A., Camus, D., Dubremetz, J. F.
Differential targeting of dense granule proteins in the parasitophorous vacuole of Toxoplasma gondii. (1991 Dec, Parasitology) PubMed / full text
   more detail about this publication

dense granule during tachyzoite
  • "All four proteins were found in dense granules by immunoelectron microscopy; in T. gondii-infected cells, they were found in the vacuolar network but, in addition, GRA 3 was also detected on the parasitophorous vacuole membrane."
  • Microscopy type: EM
  • Microscopy method: antibody directly to protein
  • Strain:
  • Gene model mapping comments: Only annotation match
  • Localisation record: dense granule during tachyzoite
  • Comment: Couldn't find Full Text – strain not recorded in abstract
  • Other genes localised in this publication: dense granule protein 1 / major antigenp24, dense granule protein 3, hypothetical protein

Orthology

OrthoMCL

Part of OrthoMCL group OG4_115531

Localised Genes in this Group
Other Apicomplexan Genes in this Group
    There are no other apicomplexan genes.
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>TGME49_027620 28 kDa antigen
MFAVKHCLLVVAVGALVNVSVRAAEFSGVVNQGPVDVPFSGKPLDERAVGGKGEHTPPLPDERQQEPEEPVSQRASRVAE
QLFRKFLKFAENVGQHSEKAFKKAKVVAEKGFTAAKTHTVRGFKVAKEAAGRGMVTVGKKLANVESDRSTTTTQAPDSPN
GLAETQAPVEPQQRAAHVPVPDFSQ

Gene-Specific Links for TGME49_027620

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins