ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_027290 (HDAC3)

histone deacetylase, putative, a gene from Toxoplasma gondii

Compiled localisation
not nucleolus and nucleus during intracellular tachyzoite

Who localised this protein by microscopy?

Saksouk, N., Bhatti, M. M., Kieffer, S., Smith, A. T., Musset, K., Garin, J., Sullivan, W. J. Jr, Cesbron-Delauw, M. F., Hakimi, M. A.
Histone-modifying complexes regulate gene expression pertinent to the differentiation of the protozoan parasite Toxoplasma gondii. (2005 Dec, Mol Cell Biol) PubMed / full text
   more detail about this publication

nucleus and not nucleolus during intracellular tachyzoite
  • "Whereas some class I- and class II-related enzymes were predominantly cytoplasmic (data not shown), TgHDAC3 (class I) was exclusively localized in the parasite nucleus, being largely excluded from the nucleolus, as observed for acetylated H4 (Fig. 2A)"
  • Microscopy type: Light
  • Microscopy method: HA tag
  • Strain: RH
  • Gene model mapping comments: blast from DQ004745.1, annotation matches
  • Localisation record: nucleus and not nucleolus during intracellular tachyzoites
  • Other genes localised in this publication: transducin beta-like protein 1 (TgTBL1), histone H3, arginine methyltransferase protein, putative

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10203

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_027290 histone deacetylase, putative
MALSALRKRVAYFYDPDIGSYYYGPGHPMKPQRIRMAHALVLSYDLYKHMEVYRPHKSIEPELCLFHSSDYISFLSSVSP
ENYKEFSLQLKNFNVGEATDCPVFDGLFTFQQACAGASIDAAKKLNHHQADICVNWSGGLHHAKRSEASGFCYINDIVLG
ILELLKYHARVMYIDIDIHHGDGVEEAFYVSHRVMTVSFHKFGDFFPGTGDVTDVGASQGKYYAVNVPLNDGMDDDSFVA
LFKPVITKCVDVYRPGAIVLQCGADSLTGDRLGKFNLTIKGHAACVAFVKSLDIPLLVLGGGGYTIRNVARCWAYETGVV
LDRHREMSPHVPLNDYYDYYAPDFQLHLTPSSIPNSNSPEHLEKIKTRVLSNLSYLEHAPGVQFAYVPPDFFGEDNDDED
EFMQNQVDNEGGGRAAGATAHTAANAPYRIRRKDYANDFEDMADRDQKVPI

Gene-Specific Links for TGME49_027290

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins