ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_027280 (GRA3)

dense granule protein 3, a gene from Toxoplasma gondii

Compiled localisation
dense granule during extracellular tachyzoite and intracellular tachyzoite and tachyzoite
parasitophorous vacuole membrane during tachyzoite
during not bradyzoite and not merozoite and not sporozoite
parasitophorous vacuole during bradyzoite and tachyzoite
oocyst wall during bradyzoite and tachyzoite
not parasitophorous vacuole during bradyzoite and merozoite and sporozoite

Who localised this protein by microscopy?

Sheiner, L., Santos, J. M., Klages, N., Parussini, F., Jemmely, N., Friedrich, N., Ward, G. E., Soldati-Favre, D.
Toxoplasma gondii transmembrane microneme proteins and their modular design. (2010 Jun 9, Mol Microbiol) PubMed / full text
   more detail about this publication

dense granule during intracellular tachyzoite
  • "Anti-GRA3 or GRASP-YFP were used as dense granules and Golgi markers respectively. "
  • Microscopy type: fixed light
  • Microscopy method: antibody directly to protein
  • Strain: RH hxgprt-
  • Gene model mapping comments: inferred from another publication
  • Localisation record: dense granule during intracellular tachyzoite
  • Other genes localised in this publication: hypothetical protein, microneme protein MIC4, gorasp2-prov protein

Blume, M., Rodriguez-Contreras, D., Landfear, S., Fleige, T., Soldati-Favre, D., Lucius, R., Gupta, N.
Host-derived glucose and its transporter in the obligate intracellular pathogen Toxoplasma gondii are dispensable by glutaminolysis. (2009 Aug 4, Proc Natl Acad Sci U S A) PubMed / full text
   more detail about this publication

dense granule during intracellular tachyzoite

Shea, M., Jakle, U., Liu, Q., Berry, C., Joiner, K. A., Soldati-Favre, D.
A family of aspartic proteases and a novel, dynamic and cell-cycle-dependent protease localization in the secretory pathway of Toxoplasma gondii. (2007 Aug, Traffic) PubMed / full text
   more detail about this publication

dense granule during extracellular tachyzoite

Ferguson, D. J.
Use of molecular and ultrastructural markers to evaluate stage conversion of Toxoplasma gondii in both the intermediate and definitive host. (2004 Mar 9, Int J Parasitol) PubMed / full text
   more detail about this publication

parasitophorous vacuole during bradyzoite and tachyzoite, oocyst wall during bradyzoite, during not merozoite

Ding, M., Clayton, C., Soldati, D.
Toxoplasma gondii catalase: are there peroxisomes in toxoplasma? (2000 Jul, J Cell Sci) PubMed / full text
   more detail about this publication

dense granule during intracellular tachyzoite
  • "Staining for the dense granules was obtained by using anti-GRA3 antibodies (Leriche and Dubremetz, 1991), an anti-MIC3 was used to detect the micronemes (Achbarou et al., 1991) and an anti-ROP2 for the rhoptries (Fig. 6)."
  • Microscopy type: Light
  • Microscopy method: Monoclonal antibody directly to protein
  • Strain: RHhxgprt-
  • Gene model mapping comments: inferred from another publication
  • Localisation record: dense granule during intracellular tachyzoite
  • Other genes localised in this publication: peroxisomal catalase, microneme protein MIC3, Rhoptry kinase family protein ROP2A (incomplete catalytic triad)

Kaasch, A. J., Joiner, K. A.
Targeting and subcellular localization of Toxoplasma gondii catalase. Identification of peroxisomes in an apicomplexan parasite. (2000 Jan 14, J Biol Chem) PubMed / full text
   more detail about this publication

dense granule during intracellular tachyzoite
  • "Catalase (green channel) does not colocalize with various parasite organelles by IFA. Micronemes (a), rhoptries (c), and dense granules (e) (all in the red channel) are labeled with monoclonal mouse antibodies to organellar proteins."
  • Microscopy type: Light
  • Microscopy method: Monoclonal antibody directly to protein
  • Strain: RH
  • Gene model mapping comments: inferred from another publication
  • Localisation record: dense granule during intracellular tachyzoite
  • Other genes localised in this publication: peroxisomal catalase, Rhoptry kinase family protein ROP2A (incomplete catalytic triad), microneme protein 2

Ferguson, D. J., Cesbron-Delauw, M. F., Dubremetz, J. F., Sibley, L. D., Joiner, K. A., Wright, S.
The expression and distribution of dense granule proteins in the enteric (Coccidian) forms of Toxoplasma gondii in the small intestine of the cat. (1999 Mar, Exp Parasitol) PubMed / full text
   more detail about this publication

during not bradyzoite and not merozoite and not sporozoite, dense granule and oocyst wall and parasitophorous vacuole during tachyzoite, not parasitophorous vacuole during bradyzoite and merozoite and sporozoite

Achbarou, A., Mercereau-Puijalon, O., Sadak, A., Fortier, B., Leriche, M. A., Camus, D., Dubremetz, J. F.
Differential targeting of dense granule proteins in the parasitophorous vacuole of Toxoplasma gondii. (1991 Dec, Parasitology) PubMed / full text
   more detail about this publication

dense granule and parasitophorous vacuole membrane during tachyzoite
  • "All four proteins were found in dense granules by immunoelectron microscopy; in T. gondii-infected cells, they were found in the vacuolar network but, in addition, GRA 3 was also detected on the parasitophorous vacuole membrane."
  • Microscopy type: EM
  • Microscopy method: antibody directly to protein
  • Strain:
  • Gene model mapping comments: Only annotation match
  • Localisation record: dense granule and PVM during tachyzoite
  • Comment: Couldn't find Full Text – strain not recorded in abstract
  • Other genes localised in this publication: dense granule protein 1 / major antigenp24, 28 kDa antigen, hypothetical protein

Orthology

OrthoMCL

Part of OrthoMCL group OG4_115540

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>TGME49_027280 dense granule protein 3
MDRTICPFFIQSFTMSTALKRLIPFLVPFVVFLVAAALGGLAADQPGNHQALAEPVTGVGEAGVSPVNEAGESYSSATSG
VQEATAPGAVLLEAIDAESDKVDNQAEGGERMKKVEEELSLLRRELYDRTDRPGLKRAVILSLGTSALIAGRMFSSTLRA
AVPWYAVAFNAIVAAYYIRKVLTYRRRVMTKRQPFMSSVKNFFRRRPKDGGAGVDKASKK

Gene-Specific Links for TGME49_027280

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins