ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_026810 ()

SET domain-containing protein / Bromodomain-containing protein, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_18658

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • PFF1440w (SET1) SET domain protein, putative
  • PBANKA_112850 SET domain protein, putative
  • PY00684 Bromodomain, putative
  • PY02230 similar to KIAA0304 gene product-related
  • PVX_114585 SET domain containing protein
  • PCHAS_112800 SET domain protein, putative
  • PKH_111920 SET domain protein, putative
  • TGME49_026810 SET domain-containing protein / Bromodomain-containing protein
  • NCLIV_046190 Multidomain chromatinic protein with the following architecture: 3x PHD-bromo-3xPHD-SET domain and associated cysteine cluster at the C-terminus, related
  • cgd8_2730 multidomain chromatinic protein with the following architecture: 3x PHD-bromo-3xPHD-SET domain and associated cysteine cluster at the C-terminus
  • CMU_026750 SET domain-containing protein
  • TA09890 hypothetical protein, conserved
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>TGME49_026810 SET domain-containing protein / Bromodomain-containing protein
MGGDNGRRREDPWIPPPPPEPQPPPPCLPASEPVPGIPLHSPQSLSSFVCSRGQRQIASACETGYQPSGYQPSDPSSHSR
QLHSRLGIHSSNSLYTDSQGTLPFSEAFTGSGSGHFSGHFPGLSVCAEPSRQLPSGPSPASWKENGVVTPSGSAAVAPLQ
VERVPAPPASRLRSRWDQRPSQTSGRAQGSNENRERPGEACAASPVQPASPPPPLPHSQGGVDGERGRRGRYSEETGERG
DTKHRGDTKDKGDTGDTRDRRDPQDRGDRRFDEGGSCVSRPQSRSEREESGEKRSWHFPRGGRRSSSVDRDHGGKGETRE
DPRCRWFLGRQRASARENEAGIRWRPEREERGSASPGRSRCGPTNKEDRPGTRRGSLESRSFLEASHSSDARHAVDRPVS
REGDESRRRSSTWAPSPAASLRRNRGLSRSVSPSEPRGWRGGEEKRRQEERGYVERSRRGSRESATGAEGKDDAFSPRSC
ASGNMFPDRQGRPRGWDEPRRPHNRGDRRWGAEAPGEEDESEGGRQARTHSRQGVERERQRHSVSGRPPVCSPLHRRLRS
LSPTSAHGRSPPRFCDTRERLPQADVCGTRESPSRGFTRFGDTAPAWSEPEAGAGHSPDMDAHAGASKSARASSSLGRRG
PRSVSPRRGESGVKPDRRSLRGDSQGRADGQRERETWRNEGESASAQHSLPETRRIGGVRMRRTQLDLLPSRASRRSSSS
SPEARPKRALPRERDRGHGTSGRNMAAPLGSSLTSRRRSSEDRHACGRARSLRDRADRRDSGKSSDSEARSSSENSRVRG
EGRDTRETGVCSDVSKGSASPSRDKRRELSPQHDEVTSDDVAPSPMTSVSRDSPSLMVSDPPSPISPPAAKESRGLLRAE
SRSPSDSRSPSWRDRESGWFRKRIVTSTADSAVPGGQEEGSTSRSPASLLLPSHPGVGDQDLPCASPFPRLAVSSFASSD
LAHVVRERPREATDEKHHEPFPASLASPPSRLGGSTAPLLSAPLQSQLQSPSLAVSKAGVSAASSLREKLAGGVKLASPD
AVFSLAGLSPCLDDIFDYDEEYERFGFFPTIRTFARPERRRRTQRTASPGPAQAAEGRRDESAQKRADGEGVDEECGKTE
RPEEADGSDSRKVRSEAKERVLASPLDSSKERSADAQADGKAEKEKKEKRDKKEKKEKKKSSERALLGQRLHGEARAEAE
KTLTKLERKLLKKQQKKERRRLEKLERKKGKDVGETKDETLNVTSDERDTERVHGVGEAVYKRGPDRDGDKAKEEETDIG
KATEQAEAVDGLTRDVEAEMSPAGATPLPEQAKAADKADEEAGEEPRDPETEREKKERKCGGETQMPRDDEKALVATETE
MKVEAMKPPGERTDTEILPKRTSEADRCATKKSRDARRGQDGEDATAPDEKEQDSGAAKVVQRSSGKKDDSGSAGAASAK
ASPCASSSRNKDTLPRELLSLLLDDYVCSASRRRRPADPQGPSSPSPKTVRSGGAAKRTGGASSKAAPPSCLEPVKREGG
DRTEEGPRRGEAGGGSSDARHTLSEKAQDVETEKGERGIKRITPKLAGLGKDEKKQKAAPLGSATAAEKTNLASEQLVRG
RASDQVKSEEEEACDLSSFDAFLVGSRTPEVGGSALDLLVEPPPEWEIARRKTLKWDEEEESVLAAALDERRPVPVHGPL
TAGGKGENEAPERAAHDGGGDAETGKAEGQGEGEETGGGMETNSESKRDGRTEDDENVFGGRTKAEQLEVGAEDETKDDE
DDEDGRLVPEKSIRKRKRRSSLDDPEIEEKITPNDPLYACLIEGSAIRLTRRMIKQLHDEEPTVSAGVSRSSPSGSAGAS
PRALEAGDSKALLMGAASTGARAGSVQAKKRSEKGPKVLSPVERPPREEGENDAGKDRPGDGSSSPPSTPGRPASPFSPA
LSGAAALNSLGRKVEVRDDAQGFSYVGCRVRVVRSWRDEKQRSTWEWGEGVIKFFLPKFRMFFIHFLLNAGGTDAATPFD
APPLDLRNEELPFSPEAQHRGWFSSAHDIIRLASSRRVWERPEKREKREKRERRTGAEKARDLCDRRRKTTETPDAAEPP
EGSESADEAETEKRASREQSDETVAVEGSPGDAAAGGEREATDERRRRREAAREDLEALEREANGNTEGSGENEKKREAN
ERARTCGEILQGDANRPSEPRTHNQESLCASSSSSSSSSSSSSSLPLCRTCCKPIAVIRTGDLTDDTSWQLAVRSLSPQT
LDSCLPPEASCGDSTLFPASSSALSKDAPLPTNALSAAANSISTDEAKEIGASGSADGYSPPKEADRPMQQVKQVHWGLR
CIRCERVFHASCITAPHQRKITVGMDQEALCEESARHRRLVARREAAIKAYAKKQAKRREDASGPATGAEPYEENAETLL
CGRRDAEGEASTLKKESENRAQPIEGEVTAGCREKKTKGVTGSETGAASGGRVKAETAAVSVASCSEVPVKKGEKTKTGE
TSEEEWTHKEACVDGASATLQLDWTEEPQGERQRSSSTSPSSTSLSRQEEAAEPSKALQTAGANASDEAALRISTIAEET
MDSPERLANGVVSQTTGKTFQEKEASASVPRREICGASAAAENCSAFAECVAAPSTSVSSASASGSVAASQIALVFVPPI
QPLAAASSSPTSSRRKREEGEGRGRRSWEDWVCADCATCRFCCEPLSLPPLGPEACGQLGAQANQPTVNCHTCNMYAHGV
CCYPPVPELHPIATFRCDACTRCQSCGYVDLYWPEYANWDIKFQRCSMCHHAIEAGQFCPVCMRVWGFDGLDDLMLLDAT
TFGDSPESRRSELGVAPHQVPDTVRRKKRRQVEDADAETDAGDSGDCPGSEAEAPTGDTGSRERGDQQARPNEQRQALVE
WVLCDGCRLWVHAKCDGLSEAHMERLACRDVLYRCPVCRGASRARKYKRLLDQLVAFDKTAEFTLPAAASFTLYWRVVTR
PMDLTTMRQKLQRGEYRRDEEVIADLWQIFHNARMVNMPNTRTYRSAVAMERKAHELLVGILQLSPGKVARRRADLKMGR
SALKGGDDRGGRNASLLDLLGDSEDLVEEGPWLRPGSTEDDEETASEKGRETVEFGSEAQDARPAGSRADSTKGVGAAVA
ARLQAPRRGSFAGPGSTRGIRETSPESRLGRRDADQNASEGRGAEAWARGNEADRGVSGSLDLHHRTAGCAVSKELQKQS
LHVHRLPKLENLPVPPSKPLDTLEDLFMLPSGNVPLLASPSTVFPVSFACGFPLAPSASLVVPEFPPTFQLAFSPNKPLP
AELPCGPHPVLGAGLLALGAPGLGEGSYLFELPSREAFSAPRKTEKPRKKKDAADDERRTKKARDSIVASLVSSPPPGAG
SSGQGLSSTGGSASGLGGDNRKKRGRKSGRPVGEKTGAASSPLPTGPDAGGDRTGEEEEAKGISVPEGFREPSRSPEREE
LPGSDEENENEDGEEQKEDAHACAEAQDGVRAPGILPKWTHIMPAVESSQDFLRAIEYIYGGAKRKRRREDSSENERKPK
TTRAGRPELEAVSNLTGKNTTGKEQTEENQRERLQGETDRSETGVTEEGMSNCQTCGEDEAGASLASRRSSLSSCDDASL
QEDPWTSLSLFEDCCALCGSTADPQSLYHCPSCGESFHGQCIGVAPSLSSSRGVQCPRCAVCVVCDGRAPCMHLEDVRNR
RTAPDSAGKVVTASSGAAGGLPAFSVAQGLEPQSKECRDLPASSTLSPKAEALRQQFHVYRCGGCGVCAHSDCVWQSGVE
IPRVSSLAPSAIASGSLGLPTNIDALLLKNGNLRPQFRPQIPHPWSAATSLSSTLPSFQSSGPSPVSVGASLVGASPSLR
ATGSARPEGSGGAAVFAGGARPASSPHATLPHASLPARVDQEKLGAVAASQAHEALGAEYPLQNRRAGKSLEGAGVRHAQ
ASSSHFSLSSELSAATGSTPGGRRPAGTWLPARTQQPDLRTASDAVRPALLSQLSHFMRCLKLLVRRLGWRPTAIAPLLG
STPETLHRMLLQLKLSPSSFGEEGQNVLQWCFFKAVEAKQRLPGFEGVRLPLPSDFQSPPPTLAEILPQLAALRQSAAFS
GSSPSSAASASASSSLASSVSSAPVASAGGAATVSAFTHSSSVPAVSASPSSVASAAPGGVQPHLSPPLTTHAVASSLGS
LSSLPLQSSALNLRPGALAHRPQSGAGASSGVAGPRGDTTASHHLPASLPPPSASPSAAATASAGLESTASDLRGLVSAE
QLLLGHRLLHSSLASSLASAGTPVSSEQAALLLQHLRESYREKQRAAPQQVKGLASAASPREAAAPAPQATLESAGSSAC
LSFSSSDGAYRGRGEGQSRRPAETPCRQEDSRGRPASVAIRESRERSPRGSYSDQKISQPKAGRPSSLRGAGQEEAPERG
SRLEDACREAGAGRRQQGSDSSGTAGVGSEREGPEASVSEGRNSADKRMSPGGEAVGNTKLEGDREPAAVECTNRFDTSS
SSVYPEAEVLSQLLSNCFPDSISSSLAFPDDPEELGCEDGTKDEEQRRRRREIRQEQLHQAAFWGLPDASPCSHDSQTDD
DPGADELQARQTRRGDGKSTRHHFLAPQDAHRGERHPVRDSSLAPSVSADVEEGRRTTRRLIREDCMHRSAPPPTPATSN
PTAASSAVPSPESATPAAAARPAAERPASAPPQADESSAALRALSSSLLSSVTAGDVHNLLFSSSGLALMTPEQQRAVLR
ALQRHLGANASRGTQVSGSLGASAHLQAPQAAHSLAPAAPRFNAAPAGGDCRPGGRGESGKPPDVAGLQTPQPESERLRR
AALQGTHLGTSSAEQGQVGTDPTSPVALLQALQQLRTAAFQSSSPSASLQERIQALLQLQQNMQGGPEGSPSAVLQSSLF
PRPASPIPSASASLGLATTGGEGGPTLPGFAFGGALTQSKKRQRSAAVESNKGAGGPEPGTSLSSMHATSAELPAPGGSP
AFGSCAPRLSPTAAKAPGSRGEQQAGGATTSATTSAATSAGQRESGSRRGPAGSPRHTAGGPGASAPHAGPVHASTMMPN
SAFLSSNCVPSVQMKPGNPGGAVPSNAPGPSPSSLRPHVRAALVHQFPSLTSLSHPPGSEPQQRLQAGSEGVPDGLSPEV
RGLPRELLATLGPKPAGNVTQPLPLRPTPPASHPGCHPSPTALSSGLSRARPNPAGSLGVSASPAQDAASLFVQQAKAGA
MALMPGAGRAVIADLSGVGTKGGTHPRPAPVSASATHAPPPLKLQRISQVPYLPSQQAALTASSPFALPAGTRQGGRPSE
QTLGGLGASAPEPGRPGQRHAGAVSVRGVYPTALFLSGSSPEGAGSLGSSLGEACLVQERLGRARSRTGGLNRDTGFPST
AREFHLSLTEPYRRGPEVGVYAPLTSSPHAASPVASVPPHGAGPEATLGGGWNLLGRQGPAWHTDWAYPGTYVGKAPPDA
SAGGEKGGEEERGRDRDATQAEGLPPLLFCGDCWRRETCKRKGERRHGVRDPEDQLGILQRTAFLPQQLLLLPASGSSYE
AERAGGGAAAQGDVESHPDAAEAGKRTSDRETKALETHGGTGPCLRSRPEERDPDVVVKCGFCGRLEGLATVGASPESSS
VPGPVLASLRAAARCAAGAFCLADASNSPVSLEETAAAADDPASASEPSSSSSCSACCESVGGDRSVGKKEALGVTPCRQ
RDETSEGREEGTQVEKTGRKRPLLLLNGLQGICAKCGPANAFEGEGMSPRTELGTCALGKRESAGNGKGGADRERKKREG
SRQDKENGAEERNDISPFYLISLFQILRTVLTAILDVRPRVDRAEAPLSPSDRERGGAAPPAEAVTIFAWMLVDAAVLPD
EEKEEETAKDATKVPRDESGKGVSEAALVSSMELRNISRSVVSWLSEQPAWSREVQAVLGRFVQKCEPEQEVEKKDDSQK
RLEALVTSVFKAFAAFVPAFPESLALSKNDGVSAPGSAAEGQATKRDAENRRVGGRLVMSGQPPQSTSVEANKQTSLASL
PFFSSSFVGASCLPPSLGVNAVSSSVLAQACIAPGSPSVRAAFRNAFLPPGGEEGRRRTVLEYGLRCNLWVLLELGLRKY
FTQGSPLSFKPHTPSWPPVSPDAPSLLVRLVAQRLRLGDDLRPTTQPLSSSLASSLLTCELCGEKGDRLVRGRLLPFGHG
LSLHSECIAWSVDPALLPSLANPRLALGVVSSAAGLQDAQEPRGAHARRSGEPLGDACVTHAAETVPVHALEAEKEDGEE
RALKRPKTTPIGVGAAASGGTHTPDVVETAGPCGPSPAVFRMPTSVEPFLELPVCLPPIEIPSEEVTEVVADAAVSRCVW
CSKLGASVYCSAPECSVKLHLACAFAAATDPRAAACGSGEALKEGEPVGLQRGREGGEETRRRDREDFQVRLPREERELS
ETRNRAFPIHVVFSRRQIWCHACWKSFPCRPGVAQRWFDPLFVALEGLSGSVCFIVARQLSQSIRLRPPCVRLRDLPTAE
QESSATVAAALLPFSGFFSLLPPPQTLAPTPPSFPTKPCHLFSFTPIYGNVESLLAPLFAFLVSSSSLLLPASSSPSSSL
AAVWSQKVALYTKQKNLVAALAPFLLRSPSLLGALVASVDSRQVLRRLGKRTACLDLPERPGAKGLRRHLGRGQVEAPTH
GDLQRPSDLANASTQDALVDACLSACLGSGWSDEEVFQLRQQTLPQGDFWLGGRPCAAVGTSTHMDALSQHRRDDVAGSS
RAAQPLIDGRARQAWNSARERPEKVPERDAMSRADVGSDGVAGTEDAHEERHNGVEESFDALNVEAENDFKRAEPLAHSG
GDAKEKAQDFGTSRQPGPAHSATAHDLSSSLFSDASLKRLSAALAASSPLTSTSASSLSSTLSPASPLSPASLPRFAVEE
KRHHVIRHGALTVLNVGTPLSYDGGTCVFPIGFVSVRRFPLPPCLQTAERCWRRAAARPRVGSASSSSPQAEKKHPEERR
SSEAQRRPTRGSYVCSISLRDGQPFFTIDILASSFGRRRMCACIFAWLPSSCRGEAHTERAILQPPDGEGEGAARAIVLE
AKNGEKEMSELRISSGANNRELDATMGDSPLSTGTRRSQDAEVPVESQRHSSLERQVDKDTKRQDAEKDCAPVWGWRLAE
GADLEETFARFLSLFHLRRPAYVEQALRGKGLENKATIPEGEENELRAAAKRKREAEPDERSHKKLGVSQETERNASEAG
EAEAPAVREFSISGYTFFGINSPYVVERIKPKVFDVLAWRALSRLGDAHHNRLGVLIGNCHRMEQWERRWPKAAPPAQSR
AGGRQREVAGEPQLGVPRDLLTHPLDEDTKAENLDELMVCSFNRISEKTGEPLAHADSSALLASGVAPSLSSSGFASASS
SPALPLFPASSSRSVSVLSRAKAKRQFDQLPPSMQYRYLQSVGVDDRLSVRSSTIHGQGLFANVPLAEGEPVIEYVGDMV
RNCVSDLREALYEKQGGGGDGACYMFRLDDNFVVDATRAGNVSRFINHSCEPNCTCRILVCEAGQKHIVIIAKTAIRAGE
EITYDYQFGIGNETDKLACLCGARSCLGRMN

Gene-Specific Links for TGME49_026810

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins