ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_026730 (ACN/IRP, Aconitase (ACN))

aconitate hydratase, putative, a gene from Toxoplasma gondii

Compiled localisation
mitochondrion during intracellular tachyzoite and tachyzoite
apicoplast during intracellular tachyzoite

Who localised this protein by microscopy?

Fleige, T., Pfaff, N., Gross, U., Bohne, W.
Localisation of gluconeogenesis and tricarboxylic acid (TCA)-cycle enzymes and first functional analysis of the TCA cycle in Toxoplasma gondii. (2008 Aug, Int J Parasitol) PubMed / full text
   more detail about this publication

mitochondrion during tachyzoite

Pino, P., Foth, B. J., Kwok, L. Y., Sheiner, L., Schepers, R., Soldati, T., Soldati-Favre, D.
Dual targeting of antioxidant and metabolic enzymes to the mitochondrion and the apicoplast of Toxoplasma gondii. (2007 Aug 31, PLoS Pathog) PubMed / full text
   more detail about this publication

apicoplast and mitochondrion during intracellular tachyzoite

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10197

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_026730 aconitate hydratase, putative
MRILVPLVFLAAQIPPASLERVSVSGFLPRALLFRRVPLPRPICTARCLEVAQARRPRNPFLLPVSSFLLPGSMKALSNI
VLPRKGISVAARSTASATAASQPLPRNSRALSKACALPASQAFEGSRRSAGAKEAHVPERHTRLHSALTQSRKMSTSRGN
PFAYVAKTLAGTEKTYYDIGALQDDRLKTLPFSIRVLLESAVRNCDGFSIKPEDVQTILDWQKASQAQKEIPFMPARVLL
QDFTGVPAVVDLAAMRDAMARLGGPPSSINPLVDVDLVIDHSVQVDFSRSPEAFEKNLAKEMERNSERFSFLKWGSTAFS
NMLIVPPGSGIVHQVNLEYLARVVMDKKVGDRAVLYPDSLVGTDSHTTMINGLGVVAWGVGGIEAEAVMLGQQISMVLPQ
VVGFELTGQMPPSVTATDLVLTVTNILRKKGVVGKFVEFYGPGVQTLTLADRATVANMAPEYGATMGFFPVDEQTLRYLK
QTGRPDEKVDLIEAYTKANHLFASPSVHAEIAFSDRVSLNLSELEPCVAGPKRPQDRVPLSEVKEDFQVSLRNPVGFKGF
GLSEEQAEKKVEMTFRGKKYTLTHGSVVIAAITSCTNTSNPGVILGAAMLARNALEKGLSVPPYIVTTLSPGSRAVTEYL
ARSGLLKDLEKLGFYTAGYGCMTCIGNTGDFDPEVSAAISQGDLVVAAVLSGNRNFEGRVHPLTRANFLASPPLVVAYAL
AGRVDFDFEEEPLGNDKEGNPVFLRDIWPSREQIAEVEAKALSASAFVKVYEHITEGTPAWNALKTAKASDLFDWDEKST
YIHNPPFFQTMQKEPAPIEDIVDAYCLLNLGDSITTDHISPAGNIAVNSPAAKYLQSKGVERKDFNTYGARRGNDEIMVR
GTFANIRLVNKLCPKDGPKSVHVPSGEVLPVYDVAMKYKAERKPMIVLAGKEYGSGSSRDWAAKGPYLMGVKAIIAESFE
RIHRTNLVGMGILPLQFQEGQNAESLGLTGKEQFNISLNKGEIIPGSLMTVKTSDGKAFDVRCRIDTELEVKYFQNGGIL
HYVLRNLTKQHSGEN

Gene-Specific Links for TGME49_026730

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins