ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_026440 ()

SNF2/RAD54 helicase family protein, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_13897

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_026440 SNF2/RAD54 helicase family protein
MFSGSGGRCVDESASLDALFSAARRLPPLTVEECAFDPESKNWVPHAAVRRLKKKEAQQLRHVRLLVQNAPTGQSKCRCC
GGKIEKGEARLGYPTADPRGPFGLLTCWLHPLFKCSSVILEEVLQTQLEDGDRAELAQILQKAREQPANGEALKVEKDEK
DVAPVHSAHAVLGEHLELAALIHGLENLDTSALTQLKATVGAVLHSLVAPAEAAAWLAAAKEKRRAEGDDEFPEGGDIAD
VMRNLVKRQIEGRRPAPPDLLLPLLPFQEEGLWWLCRQEQSEVRGGILADEMGMGKTIQIISLILARPFPPLPRALRPED
SSRERSSLPRVGQTLVVTPLAALLQWKGELEKFVRPGRLSVLVYHGPFRQALKSELEKHDVVLTTYSTLEQDFRRETNKH
KVLCKYCGRLFLPDKLAIHQRYFCGPEAVRTAKQRLTTRKRGTEKAMKTLQITTANAPIVVEEESDDEAVSQEQTRKRKL
SGRQAENSTENAAEGKTGSVDSSSSSVASSSASFLPTPSNVMKELMAEANRDLRDMRPSWVFPKPLRFARRTPFSPFCAH
EKTGDADEKPKSTETRERTRTDGEVDLGGDLSEDEVEIRRAVRTLLDMGYDRDRALAAALSCQGSIEDAVQLLAEDRVES
ESSEPDCDEANKTAERERARRLRQDLKVSRTDLPRQKLPVLQVLLRRCGLPTSGTKQQLVTRLTRFLFQDGEKEEEEASA
GGPNARARRGRAKKEGKKGEKSRTRRSELEAKKAGDSESEGSARSARPRRSSRLREVAEAAEKVQPTVNGSSAGSDVTSR
NTVVKRELTGGRRSAPRKEKCDAKGVSRGSKSASKTPSRAFVATKSGKKGKQCSSSKAARRKADHDEWTESSPSSSDEDY
EEETESSILSSEEAEEASEASEASESEMSDAAGAPPQRQRRRTGAAPAPLPGAVHPSSATEEIKLAGGLVDEEEDENDAA
VKQLVRKSVLHNVIWQRLVLDEAHRIKSRNSSTAQAVLALRTATMVCSRGGGGREENAEGDATPESRAGAPEQEADGDVR
AKRRKTERDCAKEAEGEAKPHLGPAKEGEKETSDASPSEASTNLALCDARNKSGKAHASEELAWELKVGGSRWCLTGTPL
QNRIGELFSLVKFLRVYPYAYYFCKRPGCTCRSLHFRFHEGKHCVKCGHTRMSHFSLFNQKVINPIKRCGYENDGVVALK
ILKRDVLDTIMLRRTKVERAADVKLPPLIVRIRRDALSPEERDFYESLFKQTAIQFDAYVEAGTVLHNFAHIFDLLSRLR
QAVDHPYLLVHGSLQPLDGASLLPTASRKEQPTGVCALCQDDALHTEHLTEASCGHVFHRGCLWEYVQSVPVGPGAEGTS
EALAEKKEVLGCPACYTPLTVDLSSLERQVNNAGEDDGECERRGRKGGRGKNGGNEDEQEDEKDEAELDEVLEKDERRRE
NQSGGRDCEGENSLSRQNGESQSISDLSRLLQQAGKRGPDGIMQKIKASEFRSSTKIEALYQELLEIEREDTTVKSLVFS
QFCSMLDLIEWRLKKGGIHCAKMVGSMSIVSRSNVLYAFNNDPSLKVLLISLKAGGEGLNLQIASRIFLMDPWWNPAAEM
QAIQRAHRIGQRHKEVIAIRFIAEKTIEERILQLQEKKQLVFDGTVGACDHAMTKLTQDDLRFLFQN

Gene-Specific Links for TGME49_026440

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins