ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_026400 (LipA)

lipoic acid synthase, a gene from Toxoplasma gondii

Compiled localisation
apicoplast during intracellular tachyzoite
not mitochondrion during intracellular tachyzoite

Who localised this protein by microscopy?

Thomsen-Zieger, N., Schachtner, J., Seeber, F.
Apicomplexan parasites contain a single lipoic acid synthase located in the plastid. (2003 Jul 17, FEBS Lett) PubMed / full text
   more detail about this publication

apicoplast and not mitochondrion during intracellular tachyzoite
  • "The N-terminal targeting domain of TgLipA transports a reporter to the apicoplast"
  • Microscopy type: Light
  • Microscopy method: myc tag
  • Strain: RH
  • Gene model mapping comments: blast from AJ556158, annotation matches
  • Localisation record: apicoplast and not mitochondria during intracellular tachyzoite
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10835

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_026400 lipoic acid synthase
MAYFFDFPTDTWVEDASPGGPPKRAFGHGLAAGSSHFASPVSRRRLPTITALLLFSLLSASQSGALSVSQCSRRVSLGPL
LSRVSSVSCTPSAAASALASSLYPTDSLSSVEGSVAPRPPPSSLAFVLRRVPPAAYSSSLSPSVLRFKHSLPRPLQGSLV
CAPGILGGAAGSARFAGCCGSQGRSCGSGKNPELPLKGSKDEVIPRVGTSTAGPRPDWFHVPAPQAASRGAEESRYQQLQ
KQIRGLDLHTVCEEAKCPNIGECWNGGTATLILLGDTCTRGCRFCAIKTSSKPPPPDPLEPEKVADAVAKWDIDYVVMTS
VDRDDMPDGGAGHFARTVQLVKKAKPSMLIECLVSDFQGMEESVRTLAQSGLDVYAHNIETVRRLTPYVRDKRAKYDQSL
RVLHLAKQFNPSLFTKSSIMVGLGETSEEVVRTLRDLRDHDVDVVTLGQYLRPTKQQLGVVEYVTPETFKKYQDIAEEMG
FKYVASGPLVRSSYKAGEYYMKHLIDDARKHGRRETVKQVKLEADVGTLKGTTTTFQVNEKEA

Gene-Specific Links for TGME49_026400

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins