ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_026000 ()

ATP synthase, putative, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10898

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • PF11_0485 mitochondrial ATP synthase delta subunit, putative
  • PBANKA_090140 mitochondrial ATP synthase delta subunit, putative
  • PY05978 hypothetical protein
  • PVX_092970 hypothetical protein, conserved
  • PCHAS_070260 mitochondrial ATP synthase delta subunit, putative
  • PKH_094490 hypothetical protein, conserved in Apicomplexan species
  • TGME49_026000 ATP synthase, putative
  • NCLIV_046830 ATP synthase, putative
  • CMU_008960 ATP synthase delta subunit, putative
  • TP02_0253 ATP synthase F1, delta subunit, putative
  • TA12155 ATP synthase delta chain, mitochondrial
  • BBOV_III004400 ATP synthase, Delta/Epsilon chain, beta-sandwich domain containing protein
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_026000 ATP synthase, putative
MFARAFSRFASLAAPAPQRGWNAFVLPSRHFATAAGGANPFKNQLLLTLSSPSEAIYVRTPVRSVTVPGSEGAMTMTNGH
SQTVARLKAGEIIVRKGETGDEVERFFLSDGFVLFKSPEDDSGCCTAEVLGVEVVPVSMLDKESAATALQELLQQGAGAT
DEWTKARTLLGQELLSSVIRAAP

Gene-Specific Links for TGME49_026000

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins