ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_025930 (TPI I)

triosephosphate isomerase, putative, a gene from Toxoplasma gondii

Compiled localisation
cytosol during intracellular tachyzoite

Who localised this protein by microscopy?

Fleige, T., Fischer, K., Ferguson, D. J., Gross, U., Bohne, W.
Carbohydrate metabolism in the Toxoplasma gondii apicoplast: localization of three glycolytic isoenzymes, the single pyruvate dehydrogenase complex, and a plastid phosphate translocator. (2007 Jun, Eukaryot Cell) PubMed / full text
   more detail about this publication

cytosol during intracellular tachyzoite

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10431

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_025930 triosephosphate isomerase, putative
MVRTPWVGGNWKCNGTVGSITDLCGEFGKTEFDPKTIDVVIFPPALHAPLTREKLPKKYHVGLQNCSKTHNGAFTGEISV
EMIKDFGLRWILAGHSERRQYYGESDEVVAEKVNIILQEKDLNVVLCVGEQLKDREANKTNDVVDAQLAACLPKISDWDR
VVIAYEPVWAIGTGKVATPAQAQEVHEHIREFLKAKVSEDVANKVRIVYGGSVNASNSTELILQPDLDGFLVGGASLKKD
FLDIIASGMKKNE

Gene-Specific Links for TGME49_025930

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins