ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_025550 ()

phosphatidylserine decarboxylase proenzyme, putative, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_11745

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • PBANKA_082870 phosphatidylserine decarboxylase, putative
  • PY05588 phosphatidylserine decarboxylase, putative
  • PVX_099840 phosphatidylserine decarboxylase, putative
  • PCHAS_082900 phosphatidylserine decarboxylase, putative
  • PKH_072580 phosphatidylserine decarboxylase, putative
  • TGME49_025550 phosphatidylserine decarboxylase proenzyme, putative
  • NCLIV_047160 hypothetical protein
  • cgd3_2100 phosphatidylserine decarboxylase, putative
  • Chro.30247 phosphatidylserine decarboxylase
  • CMU_001440 phosphatidylserine decarboxylase family protein
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_025550 phosphatidylserine decarboxylase proenzyme, putative
MVGMTASAVLLTFHYKFREVIAATDNVAEIQSPSKLFYLRLLFGRTRSRITGSVMNINIMPALRDPIYRTLASVGGIDTE
EIRYPLRSYKCIGHLFARTLKDKEREIEDIGTQSLASPADGVVTALGDVSSERVEQVKGATYSLRAFLGLMPKVTNPEQN
TLKFVVLHLKPKNYHHFHAPAKFDVNVLRHMTGETLPVFSSFLKRFNDIFSVNERVVMSGNWKYGCMHMVAVAAYNVGNI
RIDKEPSLRTNELRVVLRHLGGDVETRTYSRQPFEYSVGQHVGEFRLGSTIVLIFEAPHNFTWDMKPGQEVRVGQRLGGV
GPIRRAQTEDERLFAFY

Gene-Specific Links for TGME49_025550

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins