ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_025410 (CenH3, CenpA)

histone H3 variant, putative, a gene from Toxoplasma gondii

Compiled localisation
nucleus during tachyzoite

Who localised this protein by microscopy?

Brooks, C. F., Francia, M. E., Gissot, M., Croken, M. M., Kim, K., Striepen, B.
Toxoplasma gondii sequesters centromeres to a specific nuclear region throughout the cell cycle. (2011 Mar 1, Proc Natl Acad Sci U S A) PubMed / full text
   more detail about this publication

nucleus during tachyzoite
  • "TGME49_025410 showed faint labeling throughout the nucleus in addition to a more intense spot (Fig. 1C)."
  • Microscopy type: fixed light
  • Microscopy method: antibody to YFP tag, HA tag
  • Strain: RH
  • Gene model mapping comments: Taken directly from publication
  • Localisation record: single spot in nucleus during tachyzoite
  • Other genes localised in this publication: histone H3, histone H3.3 variant

Orthology

OrthoMCL

Part of OrthoMCL group OG4_33138

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_025410 histone H3 variant, putative
MARIKTTPARRAGPGSRPKLTTGSGGAVGAAPKSRVGAAFPPPSHGRKPVHRRSSAPSSPSDDDSPESSYSSRSPSPSRV
ASSSGSHSSSSRRGSHASGRPPARSGRDRGLQPRRRAPPGARVLREIKRLRESTDLLIPRMPFLRLVHEVAQDCTPPYAS
PYRFTADALMALQCASEAYLTGLMEDSYLCAMHAKRVTLMPKDLHLAQRLRHAFPC

Gene-Specific Links for TGME49_025410

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins