ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_025310 ()

ARF1-directed GTPase-activating protein, putative, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_11303

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • PFL2140c ADP-ribosylation factor GTPase-activating protein, putative
  • PBANKA_145780 ADP-ribosylation factor, putative
  • PY03828 ADP-ribosylation factor GTPase-activating protein
  • PVX_101125 GTP-ase activating protein for Arf containing protein
  • PCHAS_146010 ADP-ribosylation factor, putative
  • PKH_146180 ADP-ribosylation factor GTPase-a
  • TGME49_025310 ARF1-directed GTPase-activating protein, putative
  • NCLIV_047400 hypothetical protein
  • cgd2_3240 ARF GAP-like zinc finger-containing protein
  • Chro.20341 beta 7 subunit of 20S proteasome
  • CMU_003280 hypothetical protein, conserved
  • TP01_0810 ADP-ribosylation factor GTPase-activating protein, putative
  • TA05790 ADP-ribosylation factor GTPase-activating protein, putative
  • BBOV_IV009590 ADP-ribosylation factor GTPase-activating factor, putative
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_025310 ARF1-directed GTPase-activating protein, putative
MKTCVFVDKPCHRMDAQTASFFKQLRDESPQNFRCIDCGAPNPQWASVTYGIFICLNCSGIHRGLGVHISFVRSTTMDAW
NDKQKKMMSMGGNARCKTFFQEQGIADLPIKEKYTTKAAAYYRHLLKSQVEGTPPPPALQEGEGKQPEASLVGPTRTTSF
GSRSGSGINPVPPPTSASFTERMQQMASRSGSNVGKDFGTVADSGASQAQSDQNGRNLERSQSKWTVGYMGEGGAAVLDS
LGSGFVNFVSGAKDYTNKAISTMRGDSLTGVAGASGEEEGAPSAGPGLFEKAKDTLTTGGEWIAQKGRDLATGVAGATTG
PSGAPPPPELSADGVPVATGKDENEVKSQRSRESGVLEGINTGFQTFVAGAKEYTASAYTAVANRAEVETSEGGLFDRAK
NTFQSVSANVAGWLPSSGSETSGASSGGQETGLFSFNSFNIFQQKGSGELNRSSSSGHGLLSKEGYGSTEESSDEHPQFP
TLESRGSREGNSGAAASSSATS

Gene-Specific Links for TGME49_025310

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins