ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_025260 ()

DNA-directed RNA polymerase II largest subunit, putative, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10109

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • PF13_0150 DNA-directed RNA polymerase 3 largest subunit
  • PFC0805w DNA-directed RNA polymerase II, putative
  • PFC10_API0016 PFC10_API0016
  • PBANKA_080700 DNA-directed RNA polymerase II, putative
  • PBANKA_134400 DNA-directed RNA polymerase 3 largest subunit, putative
  • PY01037 RNA polymerase A/beta'/A'' subunit, putative
  • PY03187 RNA polymerase A/beta'/A'' subunit, putative
  • PY04439 DNA-directed RNA polymerase beta' chain
  • PVX_082395 DNA-directed RNA polymerase III largest subunit, putative
  • PVX_095320 DNA-directed RNA polymerase II largest subunit, putative
  • PCHAS_080730 DNA-directed RNA polymerase II, putative
  • PCHAS_134860 DNA-directed RNA polymerase 3 largest subunit, putative
  • PKH_082310 DNA-directed RNA polymerase II, putative
  • PKH_122370 DNA-directed RNA polymerase 3 largest subunit, putative
  • TGME49_025260 DNA-directed RNA polymerase II largest subunit, putative
  • TGME49_106290 DNA-directed RNA polymerase III largest subunit, putative
  • NCLIV_044520 DNA-directed RNA polymerase III largest subunit, putative
  • NCLIV_047440 DNA-directed RNA polymerase II largest subunit, putative
  • cgd3_2620 putative DNA-directed RNA polymerase,possible RNA polymerase A/beta'/A'' subunit, long PHYSPTS repeat at C-terminus
  • cgd6_3290 DNA-directed RNA polymerase III C1 subunit
  • Chro.30301 DNA-directed RNA polymerase (EC 2.7.7.6) II largest chain
  • Chro.60382 DNA-directed RNA polymerase II/III subunit
  • CMU_000800 DNA-directed RNA polymerase II subunit RPB1, putative
  • CMU_031360 DNA-directed RNA polymerase III largest subunit, putative
  • TP05_0029 DNA-directed RNA polymerase beta' chain, putative
  • TA03235 DNA-directed RNA polymerase II largest subunit, putative
  • TA10710 DNA-directed RNA polymerase III largest subunit (RPC homologue), putative
  • BBOV_I003360 DNA-directed RNA polymerase II largest subunit, putative
  • BBOV_III007400 RNA polymerase Rpb1, domain containing protein
  • BBOV_V000120 rpoC1
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_025260 DNA-directed RNA polymerase II largest subunit, putative
MSSLSSSAALYSSAPLKRVDQLQFGVFSSEQLRKMSVCEVTTSELYEHGMPKANGLNDLRLGTLDYRQQCRTCNMDVKNC
PGHFGHLNLVKPVYHYGFLGAVLRVLRCVCYACGKLLVDRRDPKMQHILKIRSPSRRLKHVLDACAGRKRCEGYLPLPAD
GMPVPLAEEGEGGCGCVQPRYFKEGPNIMVLFPDNREEGDEDVTEDIRRIFAAEEAYAVLRRISEEDLKMMGFDPERAHP
ASFILSTLPIPPLAVRPSVQYGSARSEDDLTLKLVDIVKTNLSLKRQGDSVPGAVLQEMVMLLQYHVTTLFDNDIPGMPV
ATTRGKKPIKSIRARLKGKEGRLRGNLMGKRVDFSARTVITGDPMLPIDTVGVPKSIAMTLTYPEFVTPLNIGQLRQLVK
TGPFDWPGAKYVIRDDGSRFDLRHAKKGGEVVLEVGYRVERHMRDGDFVLFNRQPSLHKMSIMGHQVKILPYSTFRLNLS
VTSPYNADFDGDEMNLHLAQSEETRAEIKHLMKVPKQIVSPQGNKPVMGIVQDSLLAVSKFTRRDTFLTKPMVYNLLLQI
PYWSGVVPPPAILHPVPLWTGKQLFSLLLFFDSSVSGGNTKTRINMQRDVGAGLVDRKKENLFLSERDERVIIRQGELLA
GKICKKIVGSASGSLIHLLWLEAGPERTKDFLSTLQKLTNYWLLHQGFTVGCKDIIANEETNEKVRDILDQAKKEVDKLI
RLAHRGRLESQPGKSLRESFEARVNKELNSARERSGKVAAESLDESNNIMAMVLAGSKGSTINISQIMACVGQQNVEGKR
IPFGFNERSLPHFHKFDYSPQSRGFVENSYLSGLEPHELFFHAMGGREGIIDTACKTSETGYIQRRLMKAMEDVMVYYDR
TVRNSICEVLQFLYGEDGMSGEFVEDQTVELMTLDNEKLKRLYRHDVDQESYGKGWLSDELRNEILTDYELQQPLEEEFE
AIREDKNRLCRHIFKDGETKQHIPINILRLLEFAKAQFPSGDSSRKQSPIEIARKVNELLNEKLVVVKQTTNADAISAEV
QENATIFMKAHLRTVLNSRRLLERECIGPKALQWLLGEVERHFHRALAHAGECVGAIAAQSIGEPATQMTLNTFHFAGVG
SKNVTLGVPRLKELINVAKQVKTPSLTVYLQDEIAMDQERAKDVQTHLEHTTLDRVTVVSQVIYDPDPTDTIIPQDRQWV
RDYYEFPDDDELPSNLGRWLLRIQMASKVMIDKKLTMKEIGEKIYAEFPNEELDCIWTDDNSDDLVLRIRLKQQPGEGED
EDKDEDDVAEAGDRFLQKLMVQCLAGITLRGITNISKVYMREEARTIYNNQLGKFERTNNWVLDTDGCNLEDVLPIPMVD
DTRTTSNDMTEIFHVLGIEAVRRALLRELRAVISFDGSYVNYRHLAILCDTMTQKGYLMSITRHGINRIDKGPLMKCSFE
ETVEILMEAAVFAEADHLRGVTENIMMGQLCPLGTGYFDVLIDEEKLKDASHNLDGLGGAGEFDGGVGTSPTSSDPLVIT
PDGSFTPSPHLNSVFSPMPFSTVYSSFAASPANPLSPTTLGTNAGVDTQQLGGKFSPTQQTPRSPTSPLSPLSCFSPRNP
LSPLSPSGPPGGVFSPTSPILGSALETSSPSYSPSSPQSAYFQNDGSSSAVDMVISPGGVGSDGRGRGGSYSPTSPTLSP
SYSPSAPPSYSPTSPAYSPTSALSIASPVPGVGGDGRTPLSPFSPSNNPMSPHFSASTSYSPTSPVQQSNPTSPTSPYSP
AYSPTSPRYSPTSPMYSPTFAPYSPQSPSYGAGQGPLSPSFTVQSPRYSPSSPAAYSPTSPMPNVAGSPSYEDSHAPGGD
TYSPTSPMYEANDPFSPDPFAAEVVDEVGDVAALESPTEDTLGPNQGRGGSA

Gene-Specific Links for TGME49_025260

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins