ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_025050 ()

adenosylhomocysteinase, putative, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10673

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • PFE1050w adenosylhomocysteinase,S-adenosyl-L-homocysteine hydrolase
  • PBANKA_123560 adenosylhomocysteinase, putative
  • PY02893 adenosylhomocysteinase
  • PVX_080200 adenosylhomocysteinase(S-adenosyl-L-homocystein e hydrolase), putative
  • PCHAS_123620 adenosylhomocysteinase, putative
  • PKH_101130 adenosylhomocysteinase(S-adenosyl-L-homocystein e hydrolase), putative
  • TGME49_025050 adenosylhomocysteinase, putative
  • NCLIV_047660 hypothetical protein
  • cgd3_80 S-adenosylhomocysteinase
  • Chro.30017 adenosylhomocysteinase
  • CMU_037660 adenosylhomocysteinase protein, putative
  • TA05430 adenosylhomocysteinase, putative
  • BBOV_I001740 adenosylhomocysteinase (S-adenosyl-L-homocysteinehydrolase)
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_025050 adenosylhomocysteinase, putative
MAEQSKVKDLTLSAFGRKEIELAEGEMPGLMALRKEFGPRQPLKGAKISGSLHMTVQTAVLIETLKALGAELRWCSCNIF
STQDHAAAAIVKNNSAAVFAWKGETLEEYWWCTVMALTWGEGAGPDLLVDDGGDATLLIHEGVKAEKEFARSGALPDPAA
TDNLEMKVVYKILAEGLQKDPQKWSRMAANLKGVSEETTTGVHRLLQMAKKKELLFPAINVNDCVTKSKFDNVYGCRHSL
PDGIMRATDVMLGGKRVVICGFGDVGKGCAAAMKGAGARVVVTEVDPICALQAAMEGYSVSTLESQLATADIFISATGNK
DIITARHMSQMKNNAIVGNIGHFDNEVDMAGLLAWPGIQKVNIKPQVDRFIFPEDNHGVIVLAEGRLLNLGCATGHPSFV
MSCSFTNQTLAQLDLWDNVATKRYQNDVYLLPKELDEKVARLHLPALGCELTTMSQEQAAYVGIKPEGPYKSASYRY

Gene-Specific Links for TGME49_025050

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins