ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_024520 (IMC8)

hypothetical protein, a gene from Toxoplasma gondii

Compiled localisation
exclusively basal complex during intracellular tachyzoite

Who localised this protein by microscopy?

Anderson-White, B. R., Ivey, F. D., Cheng, K., Szatanek, T., Lorestani, A., Beckers, C. J., Ferguson, D. J., Sahoo, N., Gubbels, M. J.
A family of intermediate filament-like proteins is sequentially assembled into the cytoskeleton of Toxoplasma gondii. (2011 Jan, Cell Microbiol) PubMed / full text
   more detail about this publication

exclusively basal complex during intracellular tachyzoite

Orthology

OrthoMCL

Part of OrthoMCL group OG4_26690

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>TGME49_024520 hypothetical protein
MYSSRPYPGAASAPGVPPMSSQYATSLPPNSFICAGPPPEGATLLDPVLEERIVEVIKERVENRFIEVPEVHYVEKVVEV
PHPVIEEKVVHVVKPVKQERFKYVKKPVYLDKVVEVPQIQYVDKYVDVPRYNHREKIVEVPKVLVVERIIPVLKTVRRET
VVYVDEDGSQTRVPSQPCAYDERYQTHVSTASSLTPFPPTPM

Gene-Specific Links for TGME49_024520

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins