ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_023960 ()

26S proteasome non-ATPase regulatory subunit 4, putative, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_11301

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • PF08_0109 proteasome subunit alpha type 5, putative
  • PBANKA_122290 proteasome subunit alpha type 5, putative
  • PY04193 26s proteasome regulatory subunit s5a (multiubiquitin chain binding protein). [mouse-ear cress-related
  • PVX_088150 26S proteasome non-ATPase regulatory subunit 4, putative
  • PCHAS_122350 proteasome subunit alpha type 5, putative
  • PKH_011040 26S proteasome non-ATPase regulatory subunit 4, putative
  • TGME49_023960 26S proteasome non-ATPase regulatory subunit 4, putative
  • NCLIV_048550 26S proteasome non-ATPase regulatory subunit 4, putative
  • cgd4_530 26S proteasome regulatory subunit 5a with a vWA domain and two ubiquitin interacting motifs (UIM)
  • Chro.40069 26S proteasome regulatory subunit S5A
  • CMU_012650 ubiquitin interaction motif family protein
  • TA08080 hypothetical protein, conserved
  • BBOV_II002240 hypothetical protein
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_023960 26S proteasome non-ATPase regulatory subunit 4, putative
MVLEAVMLCIDNSAYARDGDLVPSRLAVQEEVAGLIAGAKTSMHQENAVGVLTYGEERVSVHLSPTNDMGAVLSALHGLR
CGGDSDFVRGIQIAQLALKHRMNKNQKQRIIAFVGSPIKTAEKQLVTLGKQLKKNNVALDLISFGEVDHNAQRLKLLNEA
VDSNGTSCLLECRAEAGQVLSEVVLRSPLLRDPETGAGPRSMGVGEGSTSVGAMNDFGVDPNTDPELYMALQLSLQEEQN
RTARLQEQAAPSAAEEARGTEPTATNGSGADASGVPTVAQIEMMEDIDDELRQALLLSLQDYSGQPASQEAEMSEAAPAE
QRGEQAETPVEAPKEEKREQPGDSELAQVLGSLPGVDVSDPRLQEVLREAASSPDEEAKETEKNNEGS

Gene-Specific Links for TGME49_023960

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins