ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_023940 (GAP45)

hypothetical protein, a gene from Toxoplasma gondii

Compiled localisation
inner membrane complex during intracellular tachyzoite and mitosis of intracellular tachyzoite and tachyzoite
adjacent to the inner membrane complex during intracellular tachyzoite
periphery of parasite during emerging daughter tachyzoite

Who localised this protein by microscopy?

Anderson-White, B. R., Ivey, F. D., Cheng, K., Szatanek, T., Lorestani, A., Beckers, C. J., Ferguson, D. J., Sahoo, N., Gubbels, M. J.
A family of intermediate filament-like proteins is sequentially assembled into the cytoskeleton of Toxoplasma gondii. (2011 Jan, Cell Microbiol) PubMed / full text
   more detail about this publication

inner membrane complex during mitosis of intracellular tachyzoite, periphery of parasite during emerging daughter tachyzoite

Daher, W., Plattner, F., Carlier, M. F., Soldati-Favre, D.
Concerted action of two formins in gliding motility and host cell invasion by Toxoplasma gondii. (2010, PLoS Pathog) PubMed / full text
   more detail about this publication

inner membrane complex during intracellular tachyzoite

Pino, P., Aeby, E., Foth, B. J., Sheiner, L., Soldati, T., Schneider, A., Soldati-Favre, D.
Mitochondrial translation in absence of local tRNA aminoacylation and methionyl tRNA Met formylation in Apicomplexa. (2010 May, Mol Microbiol) PubMed / full text
   more detail about this publication

inner membrane complex during tachyzoite

Frenal, K., Polonais, V., Marq, J. B., Stratmann, R., Limenitakis, J., Soldati-Favre, D.
Functional dissection of the apicomplexan glideosome molecular architecture. (2010 Oct 21, Cell Host Microbe) PubMed / full text
   more detail about this publication

inner membrane complex

Blume, M., Rodriguez-Contreras, D., Landfear, S., Fleige, T., Soldati-Favre, D., Lucius, R., Gupta, N.
Host-derived glucose and its transporter in the obligate intracellular pathogen Toxoplasma gondii are dispensable by glutaminolysis. (2009 Aug 4, Proc Natl Acad Sci U S A) PubMed / full text
   more detail about this publication

adjacent to the inner membrane complex during intracellular tachyzoite

Gaskins, E., Gilk, S., DeVore, N., Mann, T., Ward, G., Beckers, C.
Identification of the membrane receptor of a class XIV myosin in Toxoplasma gondii. (2004 May 10, J Cell Biol) PubMed / full text
   more detail about this publication

inner membrane complex
  • "In untreated cells, the plasma membrane protein SAG1 is evenly distributed over the parasite circumference, whereas TgGAP45 distribution reveals an anterior gap (arrows) consistent with localization to the inner membrane complex."
  • Microscopy type: Light, EM
  • Microscopy method: monospecific antibody directly to protein
  • Strain: RH HXGPRT–
  • Gene model mapping comments: Blast from AAP41369
  • Localisation record: inner membrane complex
  • Comment: Protein complex: myosin-A, GAP45, GAP50
  • Other genes localised in this publication: myosin A, putative, SRS29B (= SAG1, P30), acid phosphatase, putative, myosin light chain TgMLC1

Orthology

OrthoMCL

Part of OrthoMCL group OG4_27863

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>TGME49_023940 hypothetical protein
MGNACKKNTAKTPTRKEAEDLAEKERQEREAKEKAEAEEKARAEAEKNAADKAEAERRAAEAREREESARKEAEAEAARK
AEAEAAEAERLRKEAEKKKAEEAKRKAEEEQRAAAEEAEQRAREEAERRKAEAAAAAERERQMQEALKQEEMSPREKYDK
LASPEDSASETTMATQPQKVAEHSSAAVTDRSVVGYTVTPCDMASIDETAKYLSKRCGCDLGDQHDENECPICRHIDLSD
APLLN

Gene-Specific Links for TGME49_023940

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins