ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_023390 ()

sec63 domain-containing DEAD/DEAH box helicase, putative, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10162

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • PF14_0370 DEAD/DEAH box helicase, putative
  • PFD1060w u5 small nuclear ribonucleoprotein-specific protein, putative
  • PBANKA_052290 u5 small nuclear ribonucleoprotein-specific protein, putative
  • PBANKA_130300 DEAD/DEAH helicase, putative
  • PY00412 RNA helicase-related
  • PY04061 Drosophila melanogaster CG5931 gene product-related
  • PY05116 Unknown-related
  • PVX_090165 u5 small nuclear ribonucleoprotein-specific protein, putative
  • PVX_118535 RNA helicase, putative
  • PCHAS_052310 u5 small nuclear ribonucleoprotein-specific protein, putative
  • PCHAS_130620 DEAD/DEAH helicase, putative
  • PKH_052600 u5 small nuclear ribonucleoprotein-specific protein, putative
  • PKH_126720 RNA-helicase, putative
  • TGME49_023390 sec63 domain-containing DEAD/DEAH box helicase, putative
  • TGME49_049810 activating signal cointegrator 1 complex subunit 3, putative
  • NCLIV_049050 RNA helicase-related protein required for pre- mRNA splicing (EC 3.6.1.-), related
  • NCLIV_065940 hypothetical protein
  • cgd2_2770 U5 small nuclear ribonucleoprotein 200kDA helicase, Pre-mRNA splicing helicase BRR2 2 (RNA helicase plus Sec63 domain)
  • cgd5_2960 U5snrp Brr2 SFII RNA helicase (sec63 and the second part of the RNA
  • Chro.20293 hypothetical protein
  • Chro.50077 hypothetical protein
  • CMU_005190 DEAD/DEAH box helicase family protein
  • CMU_038850 Sec63 domain-containing protein
  • TP01_0582 RNA helicase, putative
  • TA18045 u5 small nuclear ribonucleoprotein-specific helicase, putative
  • TA20175 DEAD-box helicase, putative
  • BBOV_I001530 helicase, putative
  • BBOV_III000950 sec63 domain containing protein
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_023390 sec63 domain-containing DEAD/DEAH box helicase, putative
MAEEFERFKRFEYRQNSNLVLQRDTSTGVAPAVHLGEPTGEPESLAGRKLYPMGDKVERGLKKEDRPVKNDSKRAKLKRN
KLDLKRGATVLDADVTEIFFYKPTTQQTRLVYEQLLVTLQQQLGDQPDEVLKGAADEVLAALKADGCRESEKKKNVEQVL
GPVNSDVFTRLHQLAKNITDYSLGGEEEDGAQAGGLDGSTGVAVVFDEEEEEDANELMEAEVLPGEEEEEDEEEEEDADR
TYLAAKAVDEEELADRDAYELDISKIDPHWLQRELNGVFKDPNKAVATEKEILSILPTPDIQKCENQLVVILKYENFELA
KRILKNRWKIFFAVRLGQAQSPEEKNAIFEEMRSSPEGQEVLELLDALSSRRNKEKEIAINVRKEAASLAAKAQARAASL
RAAEFAEDDAGGGAGLHASHASSAFPKKTGNARDAETKNEGGGAEAPQASRGAKKPTAAVDLAAVAFHQGGHFMSNSRVK
LPDGARRIETKNYDEVVVQAFKKPQETADARQPISALPEWAQPAFSCVNIETLNPMQSKVFRVAFEEFHENLLLCAPTGA
GKTNVAMLAILNVIGRHRNAKTGAVDLASFKVVYISPMKALVAEQVQAFSQRLQPYGVSVRELTGDVNLTRQQIEETQVI
VTTPEKWDIITRKAGERAYTQLVRLVIIDEIHLLHDARGPVLESIIARTIRQIETAQEHIRLVGLSATLPNYDDVAVCLR
VAPEKGLFFFGNHYRPVPLKQTYIGIKDKKAIKRYNTMNEVTYEKLMESAGKSQVLIFVHSRKETVKTARFIRDMAMQRD
TLPRFLQHMTASREILQSEAEAVKTGDLKELLPYGFAVHHAGLPRTDRKLVEDLFADRHIQVLVSTATLAWGVNLPAHTV
IIKGTQVYLPEKGAWAELSPMDVLQMMGRAGRPQYDTSGHAILITQHSELQYYLSLNNQQLPIESQMLSCLPDMLNAEVV
LGSVRSREDAVNWLGYTYLYVRMLKNPSLYGVPPEDAERDKLLEQHCVNLVDSALKILDKNFLIKYDRRMGAIQVTALGR
VASHYYIKYPTIAVYNQHMKPTLSDIELLRLFSLSSEFKYMPVREEEKVELQRLMERVPIPVKGSPDETSSKVNVLLQAY
ISKLKLEGLAMMADMVYVQQSANRIMRAIFEICLRRGWAMLALRALRFCKEIDRRMWSSMTPLRQFKVLPEELLRKIEKK
DLPFERYYDLSSTEIGELVRVPKMGKLLHRLIHQFPKLELAAFVQPLTRTCLVVELTITPDFQWEAKVHGSGEVFWVLVE
DVDGEQILHHEMFIMPPFTGEVEHTLCFTLPITDPLPPNYSIRVVSDRWLLSESSLPISFKSLILPERTPPHTELLDLQP
LPITALRDAKMEQVYSGSFKAFNPIQTQVFSTLFATNENVLLCLPPTSGKEICLEFALLRMVKTEPASQWKAVYIAPHPL
VVKERLEDWVTKLGRGLGLKLAELTGEMQHDMKLVEQSQLILATPENWDFVSRRWKTRKALQSIRLLLVDDLHLLNSSVG
STLEICLSRTRYISAQLQRPIRIVAMANSLANAKDVGDWLGVSSSGLFNFHPSVRTVPLEISLHGFDVYHREARLLAMSK
AVYQAVKLYTRDDDRSTLKKLKNVIVFCSDRRHCRLTAIDLLLQAAADDDPKKFLHVSDEVMRKYTSVVRDKMLSETLAY
GVGLLHSGLSAAEQQLVQQLHAAGAIQVVVVAEECAWGLQMYAHLVVIVDTKKFTENGYEDYTVADVLQMLGHATRPSID
KHGFAVLFCPSSKREFYKKFVFEPLPVESQLEQNLVDHINAEVVLKTIENKQDAVDWLTWTFLYRRLAKNPNYYGLQGVS
HQHLSDYLSELVESSVHTLEQAQCVSEQNEVDLQPLNLGLVAAFYYVKVNTIELFNRSLTPTCKRRALLEILAASSEFST
LPLRPGEEGTLKGLAQRLGVRLPANSEDLNKPSTKALILLYAHFNRTPLPSDLIADQKVLLEPSIRLLHALVDVISSNGW
LVPALSAMEICQAVVQAMTTACSALKQLPHFTDELVEQAKEMGVDDIFDLMNMDEKEREKLLKPLTPSQLKDVAKASNRY
PVVNVEFQVSKKDDVLPNENLQCTVTLERDCAEETSGAVYAPYFPREKEEQWWLVVGRASSNSLAAIKRLSLNKPTTTVT
LSFEAPETDGKHSYVLYLMGDSYVGGDQEYKFDVRVRS

Gene-Specific Links for TGME49_023390

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins