ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_023000 (DLC)

dynein light chain, putative, a gene from Toxoplasma gondii

Compiled localisation
attachment site of subpellicular microtubule and centriole and conoid fiber ends and spindle pole during tachyzoite

Who localised this protein by microscopy?

Hu, K., Johnson, J., Florens, L., Fraunholz, M., Suravajjala, S., DiLullo, C., Yates, J., Roos, D. S., Murray, J. M.
Cytoskeletal components of an invasion machine--the apical complex of Toxoplasma gondii. (2006 Feb, PLoS Pathog) PubMed / full text
   more detail about this publication

attachment site of subpellicular microtubule and centriole and conoid fiber ends and spindle pole during tachyzoite
  • "EGFP-TgDLC localizes in spindle poles and centrioles, in a bright spot at the apical end of the parasite, in an apical cap extending down the periphery of the parasite for ~ 1.5 ?m, and in a small ring at the basal end of the parasite. The apical cap extends for a much shorter distance than do the subpellicular MT. οΎ… This intensity distribution correlates exactly with higher resolution localization by immuno-EM (Figure 5C), revealing specific localization to the two ends of the conoid fibers as well as at the sites of attachment of subpellicular MT to the polar ring, the (?)end of the subpellicular MT"
  • Microscopy type: Light, EM
  • Microscopy method: GFP tag
  • Strain: RH
  • Gene model mapping comments: taken directly from publication
  • Localisation record: conoid fiber ends and attachment site of subpellicular microtubules and spindle poles and centrioles during tachyzoite
  • Other genes localised in this publication: membrane skeletal protein IMC1, putative, calmodulin, putative, calmodulin, putative, phosphatidylinositol-4-phosphate 5-kinase, putative, caltractin, putative

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10763

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_023000 dynein light chain, putative
MQLKFVMIYQTVIIEFFAVFSIVMRRMKEPISRIPRSLIQATCCTGMVAMADRKAVIKNADMPEDLQQDAIDCANQALEK
YNIEKDIAAFIKKEFDRKHNPTWHCVVGRNFGSYVTHETHHFIYFYIGQVAVLLFKSG

Gene-Specific Links for TGME49_023000

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins