ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_022860 ()

eukaryotic translation initiation factor 3 subunit 9, putative, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_11549

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • PFE0885w eukaryotic translation initiation factor, putative
  • PBANKA_123250 eukaryotic translation initiation factor 3 subunit, putative
  • PY01620 hypothetical protein
  • PVX_080365 Eukaryotic translation initiation factor 3 subunit 9, putative
  • PCHAS_123310 eukaryotic translation initiation factor 3 subunit, putative
  • PKH_101510 eukaryotictranslation initiation factor 3 subunit, putative
  • TGME49_022860 eukaryotic translation initiation factor 3 subunit 9, putative
  • NCLIV_005900 TRANSLATION INITIATION FACTOR 3 SUBUNIT 9-like protein, related
  • cgd2_360 prtip-like IF39 eukaryotic translation initiation factor 3
  • Chro.20043 hypothetical protein
  • CMU_002220 hypothetical protein, conserved
  • TA07540 eukaryotic translation initiation factor, putative
  • BBOV_II003250 eukaryotic translation initiation factor 3 subunit, putative
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_022860 eukaryotic translation initiation factor 3 subunit 9, putative
MVRIDKDDLPAEEQDLLEFLSEDSDEGEDDDSEQGEEKLKEKLSQMEPLLQMDYSFPSTIVLVGVPKVGKDKHEKLRLVL
DKKMGEELLKKGAESVNEGLTISMPVNEETGMTKGFCFVTFSNQFNAQHAAHHLNGWALDAKHTFRAALLDDFDEIVGRG
ANYRPPIKLLGFTRENFRWWLLDARGREQFVIRYAGETEIYWHDPIERDCSVLVYNGHRERADGKRVWTDFRVQWSPQGS
FLATFHRPGIALWAGDQFEKKVRFEHKDVKQIDFSPNETYVITWDGSPAQLRNEKAVRIWKVMTGELLRQFPTPAYSPRG
GEYPHFLFSHDDRYVARMGEKELCVYQMECDDEPEAEGEKSDEKGRKDRCAVRLLRDPRDGKLSSLKYPLEKFEWSPTEN
IISVWIKGSEDAPGRLLLVEIPSRRELSSKNVYNVKGASMHWQSKGDFLCLRTVAFKKTGKKGKKEFTQLEIFRMREKDI
PVDNVQLNDVAVQLHWEEGYSKRFALVVHDEQTSNQALRFYRVCDASEDGKRDTILIYSFDISGYMNYMQWSPFGSYFIL
ASLGLDGTLLFCCLNDQDTVQVLHMDEHFMVNEVRWSACGRYLSTAVVLPMLPSSNTASFRLGSNTGYKIWTFQGKLQYK
CQKDQFYQFLWRPHPPSLLKKEKIEEIKKKMKDYSKRYEAEDEKLRLEQRSAFIRQRKEEMDEFTKVLDGLNQWKVDHEL
YDDWQLAYETFDAQFDWEDKEEVIEDELEVKEEIIT

Gene-Specific Links for TGME49_022860

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins