ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_020940 ()

ribosomal RNA large subunit methyltransferase J, putative, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10397

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • PF13_0052 ribosomal RNA methyltransferase, putative
  • PF13_0286 large subunit rRNA methyltransferase, putative
  • PBANKA_113090 methyltransferase, putative
  • PBANKA_140810 ribosomal RNA methyltransferase, putative
  • PY02347 FtsJ cell division protein, putative
  • PY03106 FtsJ cell division protein, putative
  • PY05898 FtsJ cell division protein
  • PVX_114700 FtsJ-like methyltransferase, putative
  • PVX_122310 ribosomal RNA large subunit methyltransferase J, putative
  • PCHAS_113040 methyltransferase, putative
  • PCHAS_141000 ribosomal RNA methyltransferase, putative
  • PKH_111690 methyltransferase, putative
  • PKH_140850 ribosomal RNA methyltransferase, putative
  • TGME49_007990 ftsJ-like methyltransferase domain-containing protein
  • TGME49_020940 ribosomal RNA large subunit methyltransferase J, putative
  • NCLIV_002910 ftsJ-like methyltransferase domain-containing protein, putative
  • NCLIV_004720 ribosomal RNA large subunit methyltransferase J, putative
  • cgd4_1580 Spb1p-like, FtsJ methylase
  • Chro.40181 FtsJ cell division protein
  • CMU_004600 rRNA (uridine-2'-O-)-methyltransferase 3, putative
  • TA07980 ribosomal RNA methyltransferase (FtsJ homologue), putative
  • TA11330 hypothetical protein, conserved
  • BBOV_II002180 ribosomal RNA large subunit methyltransferase J protein, putative
  • BBOV_III009210 ribosomal RNA large subunit methyltransferase J family protein
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_020940 ribosomal RNA large subunit methyltransferase J, putative
MAALSSGSSPFVSIVSPLRRGVEEAAAVAKNGRSHSYGAVASSCSSSSRSSSPGETTSSSFDACGCSSSLTASRACLVPG
FAQNAAGASRVGCLDSRTGGGRRAYSGEPRIRNKNSSHTSEWIKRQITDRYVLRAQERNLRSRAAFKLEQLDDDFLFFRK
NQVVVDLGAYPGGWSQVALDRIRAGGGEGRVIAVDPVAMDPLPHHTFIQGSVGQAGTLQALLEELGESKADVVLSDMAPA
CIGVKQDDHLNCAELCLFASDLMEQVLKLGGTFVTKMFMGSETNNFKVYLRTRFKKVSSAKPRACRQESREMYFVCQHFV
GRDRLAEEVQLKGCFTGKEGFL

Gene-Specific Links for TGME49_020940

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins