ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_019550 ()

dihydrolipoamide succinyltransferase component of 2-oxoglutaratedehydrogenase complex, putative, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10785

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • PF13_0121 dihydrolipamide succinyltransferase component of 2-oxoglutarate dehydrogenase complex
  • PBANKA_141910 dihydrolipamide succinyltransferase component of 2-oxoglutarate dehydrogenase, putative
  • PY03521 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase, putative
  • PVX_122850 Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, putative
  • PCHAS_142090 dihydrolipamide succinyltransferase component of 2-oxoglutarate dehydrogenase, putative
  • PKH_141980 dihydrolipoamide succinyltransferase, putative
  • TGME49_019550 dihydrolipoamide succinyltransferase component of 2-oxoglutaratedehydrogenase complex, putative
  • NCLIV_061040 hypothetical protein
  • CMU_020490 dihydrolipoamide succinyltransferase component of 2-oxoglutaratedehydrogenase complex, putative
  • TP01_0262 dihydrolipoamide succinyltransferase, putative
  • TA19690 dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial precursor, putative
  • BBOV_IV004840 dihydrolipoamide succinyltransferase, putative
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_019550 dihydrolipoamide succinyltransferase component of 2-oxoglutaratedehydrogenase complex, putative
MPVLAAAAAASRRGLSSLLLPVECRPRFSAGVSSAVQAGKKVCSIKSAFSAVARHRSRPLASLSSLATPSLAFRDARWTS
VTSRCFSSAAGAETVVPVPSMGDSITEGSLNEWKKQPGEYVKEGELVAVIDTDKVSVDINAPQAGRIVRFEANAGDTVEV
GKPLYVIDPTAQPDPAELAAAAAAAAAPATPVKTEAAKPVSPPEKSSVPQPAPSVSPPKPAPAPKKPASPVVAVQSPGRE
EKRVPMSRMRQRIAERLKGAQNTAAMLTTFNECDMGALMAMRSELNPAFQERHGVKMGFVSAFMLASAMAMKKVPEVNAF
IEGNEIVYKSHVDISVAVATPTGLMVPVVRDCERKSWPELEKELAHLAVKARNNQIALEDMAGGTFTISNGGVYGSMMGT
PILNPPQSSILGMHGITKRAVVKNDQVVIRPMMYLALTYDHRLIDGREAVTFLCHIRDYIEDPRLMLLDL

Gene-Specific Links for TGME49_019550

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins