ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_019280 (ALP1)

actin, putative, a gene from Toxoplasma gondii

Compiled localisation
nuclear envelope and transport vesicle
inner membrane complex during inner membrane complex formation before arrival of imc1 and tachyzoite cell division
not nucleus during tachyzoite cell division and tachyzoite
not acidocalcisome and not dense granule and not microneme and not microtubule and not parasite plasma membrane and not rhoptry during tachyzoite
cytoplasm and cytoplasmic foci during tachyzoite cell division

Who localised this protein by microscopy?

Gordon, J. L., Buguliskis, J. S., Buske, P. J., Sibley, L. D.
Actin-like protein 1 (ALP1) is a component of dynamic, high molecular weight complexes in Toxoplasma gondii. (2010 Jan, Cytoskeleton (Hoboken)) PubMed / full text
   more detail about this publication

cytoplasm and cytoplasmic foci and inner membrane complex and not nucleus during tachyzoite cell division
  • "In addition to its enrichment at daughter cell membranes, ALP1 is localized throughout the cytoplasm both diffusely distributed and concentrated in clusters that are detected by fluorescence microscopy, suggesting it forms complexes. GFP(2)-ALP1 was excluded from the nucleus and exhibited a pattern of diffuse staining with dispersed foci, while GFP alone was more uniformly distributed and was not excluded from the nucleus (Fig. 1). In this regard, GFP(2)-ALP1 differs somewhat from native ALP1, which is not excluded from the nucleus [Gordon et al., 2008]."
  • Microscopy type: Light
  • Microscopy method: N terminal tandem GFP tag
  • Strain: RH
  • Gene model mapping comments: inferred from another publication
  • Localisation record: IMC and cytoplasmic foci and diffuse cytoplasm and not nucleus during daughter cell formation
  • Other genes localised in this publication: -

Gordon, J. L., Beatty, W. L., Sibley, L. D.
A novel actin-related protein is associated with daughter cell formation in Toxoplasma gondii. (2008 Sep, Eukaryot Cell) PubMed / full text
   more detail about this publication

nuclear envelope and transport vesicle, inner membrane complex during inner membrane complex formation before arrival of imc1, not acidocalcisome and not dense granule and not microneme and not microtubule and not nucleus and not parasite plasma membrane and not rhoptry during tachyzoite
  • "ALP1 does not localize to previously defined compartments in Toxoplasma. Parasites were stained with antibodies to proteins found in different subcellular compartments in Toxoplasma, including HMGB1 in the nucleus, p30-GFP-HDEL in the ER, SAG1 in the plasma membrane, H-ATPase in acidocalcisomes, MIC2 in micronemes, GRA1 in dense granules, ROP1-GFP in rhoptries, and TUB in microtubules (see Table S2 in the supplemental material). Immunoelectron microscopy localized ALP1 to a discrete region of the nuclear envelope, on transport vesicles, and on the nascent IMC of the daughter cells prior to the arrival of proteins such as IMC-1."
  • Microscopy type: Light, EM
  • Microscopy method: antibody directly to protein, GFP tag
  • Strain: RH, ME49
  • Gene model mapping comments: blast from AY707783, (updated) annotation matches
  • Localisation record: nuclear envelope and transport vesicles, IMC during IMC formation before arrival of IMC1, not nucleus and not rhoptries and not microtubules and not plasma membrane and not acidocalcisomes and not micronemes and not dense granules during tachyzoite
  • Other genes localised in this publication: actin, SRS29B (= SAG1, P30), bradyzoite antigen, putative, microneme protein 2, dense granule protein 1 / major antigenp24, rhoptry protein, putative, membrane skeletal protein IMC1

Orthology

OrthoMCL

Part of OrthoMCL group OG4_23363

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>TGME49_019280 actin, putative
MAEYETEELATGGMPGDGAGFYDAPPAVIIDNGSGYMKAGLASQEEPSAVFPTIVGRPRRRFVDLYAAKGDGDGSGAVFV
GEEAIANRHHLSFTYPIDHGHIDNWVDMEEVWNATYNMLGVQPNEHAVLVTEPPLCSQRHREKMAEMFFETYGAPEMNIS
VTGLMAIYGTGRATGFVLDIGEGITQCVPVFDGYLEKASVKRSDFGGQELQMYLQKILCDMGYPMTTRDDYEHVRVIKET
LCFCSLNPSEDQNRDDLEKTYHLPDGLTLRDGITTEITLGPERFYPPEALFNPQLCGRDSPSLIELVWSSIMACPIESRK
SLIGSIVLSGGSSMFPGFPERLEQELKNTAPPQARPHVHVLSHPSRGSLVWQGARLYCQPEMRPLQDHIWITRQEWEEIG
MKIVAKKAAFRITS

Gene-Specific Links for TGME49_019280

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins