ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_018840 (MSH-1)

mismatch repair protein, putative, a gene from Toxoplasma gondii

Compiled localisation
mitochondrion

Who localised this protein by microscopy?

Garrison, E. M., Arrizabalaga, G.
Disruption of a mitochondrial MutS DNA repair enzyme homologue confers drug resistance in the parasite Toxoplasma gondii. (2009 Apr, Mol Microbiol) PubMed / full text
   more detail about this publication

mitochondrion
  • "Dual labelling of the mitochondria and TgMSH-1 in all parasites analysed confirmed that the TgMSH-1 signal coincides with MitoTracker labelled parasite mitochondria."
  • Microscopy type: Light
  • Microscopy method: antibody directly to protein
  • Strain: RHΔhpt
  • Gene model mapping comments: Blast from FJ167393.1, annotation matches, wrong gene model?
  • Localisation record: mitochondria
  • Comment: epub ahead of print
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_116065

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>TGME49_018840 mismatch repair protein, putative
MGGDSVCSDRDQEWRFSSRQEFFCSIASRALRPASGPGAPLRGSASFARYRWKLQTILFSLVCISVEVNARLLMEMFPRQ
RGCRQGLACSVPQAYWSINALLSANKMHGRTSKSFLQKVGDFFEAYGLDAVLLVEYCGLNPMGGKAKAGCPKQNLQQTLD
CLTSEGFSVSVFEEFASPVAATPIAPGNRKLRLLTQIVSPSSPLYLPAHMPLYEGEIGAHTPDSEPIFSLYYSPSAGYAC
GEIDVPQRTLRVEGGLTADGVEMRITSATGGAPRGELYVHQMSALGVRDDGTTRLAKRLFPSLQKIYLRDYSSPSAFHRA
VLRHLTASLQVPHSEFTIRSHLDYFSPSVAVPEPAASPADPCLLSPSELGASQAPPARNGSLSFPENRAPFPPEPQLSTA
ALSAEDARRQAETLERGLAEDGRARTDAALRSASEESPAEPPRQNSGEVVSPHSQQVPPLLARPQKHRPHPLYVSTASQL
GLLRPSGRQGNTVASTSSFVVPPLHLAALPPGAPVTSTRFIQRLLLFPPPHAVADAVQNILRQLLRLGCTDSRLSSTFMK
HFPGSSSPSAERSQAPTGKEEGDGVCVGCQSPPRATDFSAKNRSSERGLAQSGQAAALDSSAENLATHAENSDVLLVPSV
RVMDAGKLVQVISSRSANRRFFLEVLTLLAPTRYCLRRYPPSLLKPLLTVLQHETQQQVCQERFLQGVEKAIALIEQVLL
LEEEEQEAAAEGAALAAIAAAEQMSRLAASEVQGRPFENLSPHSQSAQSGENSTFGGDSRDIYSAADAAAAAARAVAEAA
AAREAAEEAAARAMATVAGGHATSSSTRGLLPILDDYFKRMERFRGHIQPFCVPYAHALVAAAVDDLLVSIFEDFAGAAR
MPALPAVCTLEEFLPSRSRAPGGEKTPLTARDVVDLFIALERRQTPGKGSAAPSARLAWLLEKQTPVRLKIPPAALFSSI
AALQRQRLAAAKSGDFGRPAGEWLRLIAALQKKLWGDTLNESVYLKKGKPPLEPVKAISRNGREKNAKSSAALTPEFECG
VAEAQAANAVTHGVERSSCREAFEALGETPGEALVSREEGMGSGLRVTERATDLHAGEFGTNEREANEQRSAVATTPHWS
KTPEHPRDRHGHQIASAWTTPRVAACSRAYTAAKNFAASAVEKRLRELSRDLQPLLPDILLAAHLIIILQLLDPNAEAEL
KVDTLTPYYMRRPDLNTLRRQRAVQRDRAALLDREDRGSDTNRIAESRRTGTKNEELPTDDEFANANRTQSRDPLSEQVQ
KDTASLLAHASSSLSKEREVVSYSFDMHGLFVLTGENMAGKSTFCRSVLALVVLANAATTVPRYGAFLASSYMAHDSPLE
NKSFFYEELSQLHNILSQARSYGKVLPEKTAALPASLLSSDTSDAGVSLRTETADVALTTPFVIVDEPCKGTAPKWGAGF
VGAALELLCRGNTHGVLSTHLHHELSRLPLDLQPNVRFKRMGVRKRNPTSLVLPESCSGPASLTGGRDLPRFKSSQPLSS
PLDSDKRTHFAAGSLGDDRLYTFELLDGICQDSNAMQTAWKVGMPSGIITRANALQAHLDAVDQGKIPCKIGGVSRGAVI
KDGDGANTGISSETSDEIVSSGTIAEKRFPEMHETPKQPPDELPRHRNENGQEPQGTTADVSETVQLHTFHQPNPENAGS
PNGEPTPCGGIGLFAEPQGIVDFPNRSASVMSAFASSAMASNALLARLRLAMIETTRELTCANAPAECVRNQAESRNNAL
HSVDTNAERPPLKIASAKDVLPVLELPALSRRLAAPPPWQDCSACVYMLVAPCTAARNAHRRAYLASEVPMRRPPDFPAQ
EATRSRASADEPAGFCANVYVGETERLETRLRTHSRSPLWAHARVLVVRVKNKAEAREVETALIRRLKEEKGVVLMSLKD
GNRRASGLSVREDVSTSESQDGRD

Gene-Specific Links for TGME49_018840

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins