ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_018820 (NF6)

hypothetical protein, conserved, a gene from Toxoplasma gondii

Compiled localisation
cytoplasm and nucleus during intracellular tachyzoite

Who localised this protein by microscopy?

Olguin-Lamas, A., Madec, E., Hovasse, A., Werkmeister, E., Callebaut, I., Slomianny, C., Delhaye, S., Mouveaux, T., Schaeffer-Reiss, C., Van Dorsselaer, A., Tomavo, S.
A novel Toxoplasma gondii nuclear factor TgNF3 is a dynamic chromatin-associated component, modulator of nucleolar architecture and parasite virulence. (2011 Mar, PLoS Pathog) PubMed / full text
   more detail about this publication

cytoplasm and nucleus during intracellular tachyzoite
  • "TgNF5 and TgNF6, fluorescence signals were mainly detected in the parasite cytoplasm (Figure 3A). However, we cannot rule out the presence of TgNF5 and TgNF6 in the parasite nucleus, as superimposition of ENO2 signal (red) and DAPI (blue) with TgNF5 or TgNF6 fluorescence (green) showed profiles, which significantly overlap on the nucleus periphery (Figure 3B), suggesting that these Alba homologues may have regulatory functions in both nucleus and cytoplasm, as previously described [34], [35], [37]."
  • Microscopy type: fixed light
  • Microscopy method: antibody
  • Strain: 76K
  • Gene model mapping comments: Taken directly from publication
  • Localisation record: nucleus and cytoplasm during intracellular tachyzoite
  • Comment: Non-native promoter
  • Other genes localised in this publication: DEAD/DEAH box helicase, putative, pinin/SDK/memA/ domain-containing protein, 46 kDa FK506-binding nuclear protein, putative, hypothetical protein, enolase 2, hypothetical protein, conserved, hypothetical protein

Orthology

OrthoMCL

Part of OrthoMCL group OG4_38465

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>TGME49_018820 hypothetical protein, conserved
MADVAAAPAPNATSQAANSTEGDAAAGSARPDNSILVSMDKIPGFYARIGKRMLVGRDDKPACDEVIITGLGMATKTAIG
AASLLQRDNSATITKVETSYFSSTRTALKMVPKITIVCTKTPEFAEQIKKDKEAALMEKSPTANAVAA

Gene-Specific Links for TGME49_018820

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins