ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_018760 ()

alpha-soluble NSF attachment protein, putative, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10792

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • PFE0445c SNAP protein (soluble N-ethylmaleimide-sensitive factor Attachment Protein), putative
  • PBANKA_110860 SNAP protein, putative
  • PY04299 beta-soluble nsf attachment protein
  • PVX_098015 soluble NSF attachment protein (SNAP), putative
  • PCHAS_110830 SNAP protein, putative
  • PKH_102390 SNAP protein (soluble N-ethylmaleimide-sensitive factor Attachment Protein), putative
  • TGME49_018760 alpha-soluble NSF attachment protein, putative
  • NCLIV_061620 hypothetical protein
  • cgd2_760 conserved hypothetical protein
  • Chro.20087 SNAP protein (soluble N-ethylmaleimide-sensitive factor Attachment Protein)
  • CMU_009630 hypothetical protein, conserved
  • TP02_0828 SNAP protein (soluble N-ethylmaleimide-sensitive factor Attachment Protein), putative
  • TP02_0829 hypothetical protein
  • TA15375 SNAP protein, putative
  • BBOV_II005240 SNAP protein, putative
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_018760 alpha-soluble NSF attachment protein, putative
MLRGDSGAGADASAAQLSDIPELLKKADALMKPAGFFSSLLGRGSDPDAALSIYMQCAQRYKLARQWNDAADCYVRASLA
AERGEDTSTQAQMLAEAGNVLKRVSTSDAEEQLVAAAAVYIQQGRWSQAGKLYRSVAEMYEEGEALSGLGNDGKCVSKVM
TFYKKAADTYELDEYGKSAFSQCRCKFAEYAAKSEDTIHDAIQIFEQEGDKATRNNLLQFSAKDFYLKALVLLLSSGDAV
SAQIALERYVARDPRFEGSREGRLATALVAAMQEGDAEAFTAALDDFDRISKLDPWKIHFLLKAKRRLMHGDEGGDHVGI
GDDGEVDLS

Gene-Specific Links for TGME49_018760

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins