ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_018560 (ACC2)

acetyl-coA carboxylase, a gene from Toxoplasma gondii

Compiled localisation
cytosol

Who localised this protein by microscopy?

Jelenska, J., Crawford, M. J., Harb, O. S., Zuther, E., Haselkorn, R., Roos, D. S., Gornicki, P.
Subcellular localization of acetyl-CoA carboxylase in the apicomplexan parasite Toxoplasma gondii. (2001 Feb 27, Proc Natl Acad Sci U S A) PubMed / full text
   more detail about this publication

cytosol
  • "The second ACC in T. gondii appears to be cytosolic."
  • Microscopy type: Light
  • Microscopy method: GFP tag
  • Strain: RH
  • Gene model mapping comments: blast from AF157613, annotation matches
  • Localisation record: cytosol
  • Comment: gene model inconsistent Alternate splicing?
  • Other genes localised in this publication: acetyl-CoA carboxylase, putative

Orthology

OrthoMCL

Part of OrthoMCL group OG4_11078

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • PF14_0664 biotin carboxylase subunit of acetyl CoA carboxylase, putative
  • PBANKA_133280 biotin carboxylase subunit of acetyl CoA carboxylase, putative
  • PY01695 acetyl-CoA carboxylase 1 precursor-related
  • PVX_116985 biotin carboxylase subunit of acetyl CoA carboxylase, putative
  • PCHAS_133740 biotin carboxylase subunit of acetyl CoA carboxylase, putative
  • PKH_123560 biotin carboxylase subunit of acetyl CoA carboxylase, putative
  • NCLIV_004860 hypothetical protein
  • NCLIV_061720 hypothetical protein
  • cgd8_3680 acetyl-CoA carboxylase like biotin dependent carboxylase involved in fatty acid biosynthesis
  • Chro.80425 acetyl-CoA carboxylase 2
  • CMU_005960 acetyl-coA carboxylase protein, putative
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_018560 acetyl-coA carboxylase
MTRQQAVAKIGAHAPATEAGDSASPGVSTQKAGRARDPAQTKRQAAASAESEAGPGGREDSAGSEKLGVKRDLEAVPSPA
AHADSLCTVYSPSLDSNGEQATQSSDHSLTSQRGSPESRETDGQLGREGPDACEAGAVSRGNEVLHDEDECRARRLRRTA
SVSSGSSGCALFSDEATEGEEEDVLAAFVRRMGGTHVIRRILIANNGTAAVRCIRSMRHWAYEALGNSKALEFVVMATAA
DIDANAEFIAEADFYVEVPPGPNSNNYANLHLIVQTAETYECDAVWPGWGHASENHRLPAILQTLKRKTIWIGPSPQAML
ALGDKIGSAVIAQSVNVPCVPWSGMDVTVDLSQVDPTKGLSQQTLAAACVQSAKDVLDCCAKIGYPVMIKASEGGGGKGI
RRVTNAEEVADAYRQVVNEVKGSPVFVMRMVSDCRHLEVQLLADKSGRCVSLGSRDCSIQRRCQKIIEEGPVVAAPPEVV
SQMEDAACRMAMAVGYENAGTCEFLYDPKTHQFAFLEVNARLQVEHVVTECVGDFNLPAAQLQVAMGILIDDIPDIKAYL
DSAASNKPVGKHIIAARITAEHAEESFRPTVGLVHELTFRPSRFVWGYFSIGSKGNIHAFNDAQFGHLFAHGKDRREAVK
HMVLALKDMTIRGELRTNVEALIKILEHPDFVANETHTTWLEQKVNFSSDSNDVSPVLLLGVLLAAVFESYTHFRESEEA
FVKRVEQGQLPPSIAVSYESCLVYRSTKFTLQCTYGGQNTVCVALNDSSTTVHIRRITSAGAGGSGAEQRDGGFLVRGGI
DGKSRKVYYKEDSTGLRVSFDGTTYTFTKESDPTQVRPPVSGKLVRWLVANEQQVVKGQSYAEIEIMKMYMQLHVEASGK
LMHAMSEGAVFQAGDLLATLELPPGVTVPKATPFQGRFPSSTLSTCEEHPRTRKLAKLALQREEHQRRQRMLNPLPAYRT
SREQLVNALDGYQIPRADEDEAIACFFECILNPMLPISEAKEVLAVIDSQLPEPLTSRLRSILADAEARAVAAFGLDEEP
AARLSTASISSQPPAAPNERPQSPALPRGATSGSKTHEDSRQRLKLRSDGCRDTGPKLEDQDTTPGTPDGAPARLKGGSE
VCGARPVEKASKARTLSLASHLPPFLFSFPPFALELPVDECFAAVERQLSLQAGEAATATEETEGPPKGEGGVETPHSPA
VVSEYVGVCVTRAQLQPLFDCLRKYDRGLIMAAAEDIARLLEKYLEVEELFEDSREGAAKSISMKRTEVDSAALASLQRS
HQALKRKNRLLARLFEFIRKCPVWQSPVFLQRYMRSYSHFMESLPHLHDCLQRLSTLGGGSPEYSAVSLPARQLMLIKRR
KPLEEQVRHVIHRIAQLANCARLAVSPTSPLPSSSAAAAAAAAAVAASAAASAAAAAASAAAAAATAAGPGAGAGVVGAG
AGGVGAGAGVVGGAGACPGAGCSSLNAVGACRSRLAAAAAAAAAATAAVATLSGPSSPVLLPARQPLGVATPSGRAQLLF
SGTGASPVAGGGCFFGSLEELLWDFEGCPDNVLMCLFLHANDELKRCALQLYISRHYGRHGLHEMRIHTSGEVWEGAYGL
LDELSQEKPAGAALLSSSRPSPSKMDDSALPSSCSHLPAQPPGVSSPGEAQTSAPLFGSFAGEAETPTCASFGSWSLWGG
PEVFVQRANPLLAVWTHHAVLTQEFLTEALDQIKPAPQTCSSAAASPVPPSRQVSFSHAEKAERKSVGFSSVGSEARQPS
SVSEVEEMSREPRELAATLFRRVSSTVDLASSCPSTCSFAKKEEGRHTLSPFLSHSSSSLYSPVSVSAPPAGLWPAPDGA
AAAGPPRASSGESATAETLGAASAASPMRGEGRQFEDVEVVDGGEVWEALGSASKSRLRHILTCFGGGENDETGRIARSQ
QTVAMVFDSIRSLENDFVERLVEYGRISRAMPPPPPTVDGKILQLFILDLGGPANAAANKEAHCCTVIGHLLNETASLLQ
SCNLHLVAVTLLSSSSPLSPAICGSSSFQLASASSTPVSTSKSPHIVESKAPTNGPSGGPVGAGSDGGPVGSLSSLPSSV
LSAFLREHFSENPGESSEETETPRFFYFRNSYRLPTPEVLAARASGSSQSASPPNSTSSTPSRASSPAPGVREEPRTRGG
EKGAAVLVKALAIASSENSQEAANRDLDKAPARSAFPAPAARLVRPLPPLSCPSAAQSQFLPCFVEEDLIRNTSHAQFSL
LELSRFLPHFYVRFIPTSVPDVHVFKAVPKPSGSSGPGAPAGSPQAPEKRLPAPAAATGARTQAAPRQSRGGGSRYFVRI
LVSVVTGGTAGGRSRGKETPGEARDRNAEQDELDDILSEQERRFVCGLNALEVACKSGDVDAMAGNHLLLSTTILFPAAV
SGPATAARPHRPRPASTGSVGPAPNQLCTPTAVVHRVAPGALEAAARKLMNQYERRLAKMNVKKVELRYMQRSIAGSEGP
CVPLRLVVDNPTGQSLRIRKFLEVTNPTTGEQVFSALDNRGALSLSGACSSFSLHSSLSIPGGPRPARDATSHAPRCISV
KLGDDSDFDGRPVSVPHPLPSALDVRRAQAFTVSTVFIYDFLDLFEEAIRKQWRMCPKYFLPAIVENTTALGGGRSSSGH
SANADNSTAKSFLPERVFEATELRLNRKGELEEVQREKGLNECGMVAWRVTMHTPEFPKGRRVILIGNDVTFQMGTFGVT
EDLLFQRASEIARKEGIPRIYIAVNSGARMGLANEVLKLFQVEWIDETQPHRGFKYLYVTEKDYQQLMQTDSIVAEPVQH
PVEGTVYKITTIVGAQIGLGVENLCGSGAIAGETARAYKSTFTITFCSGRSVGIGAYLTRLGQRVIQKSVNAPLLLTGYQ
ALNRLIGRDVYSSNDEIGGIDVMHKNGISHLTVKDDIEGCEAILDWLSYVPEHREGPLPIMVDPTDPVSRPVAYKPARAT
EDPRLMFTGCIDPQGNWLGGVFDRGSYREAMADWARSVIIGRARLGGIPVGVVAVETRVTEAKQPADPAMPHTSEILLTR
AGQVWFPDSAYKTAQAIWDFNQEELPLFIFANWRGFSGGQRDMFNEILKFGAYIVDALVDYKQPCFVYIPPKGELRGGSW
VVVDSRLNAEHMEMYADTESRGGVMEPSGTVEIKFRDKMLIETMRRLDRVTKQLEKEDAKLASEGLPIDAPRRQEIKEKK
EKRIQDLLPVYKQVAIHFADMHDTATRMKKRDAVHDVVMWEKSRNYFYWRLRRQLILFNLRKEITIADPTLSLIQAQNLV
FKWAEEAGHNVDGNYQFVQWACHSISFFASKLAALHAAHQMRNLHGFAHDNPTAFLEILRRLDPNLYHRLEFVSAVSEQT
QSSSSTQRSMAALSLITKPNAPGDNTGEPADGLPASHLL

Gene-Specific Links for TGME49_018560

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins