ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_018530 ()

hypothetical protein, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_12805

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • TGME49_018530 hypothetical protein
  • NCLIV_061750 hypothetical protein, conserved
  • cgd8_3510 thioredoxin-like protein, fragment
  • Chro.80403 thioredoxin-like, 32kDa; thioredoxin-related 32 kDa protein; thioredoxin-like, 32kD
  • CMU_006110 hypothetical protein, conserved
  • TP01_0475 hypothetical protein, conserved
  • TA20655 conserved protein, thioredoxin-like
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_018530 hypothetical protein
MSQARDVHSGAAGRGVVFLCLPIRRQMRVVGTGHAASQQKYYTEAVCMQWLREAQGRLCPEQVWRVSLATSRESLCEVPN
IKRSSAFISHVNKAADSAFDRLGLSRGFSAITACWGGRQRFACSVNRNLGDTILIFHGLRRVSSARLLKRYGSIDTQREK
VVDIHIGIMEGTSLMSLIDKSKVECLNEDAQHSIRDIIEQTSKSAYLSSSNEDPQLLIKLGFTSPVKLSSLMIKSPPGSA
AAGEVPTTIKLFTNNLAMGFSEAESEPPIQEVMKEWKPVKESERLAPNDT

Gene-Specific Links for TGME49_018530

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins