ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_018520 (MIC6)

microneme protein MIC6, a gene from Toxoplasma gondii

Compiled localisation
microneme during intracellular tachyzoite and tachyzoite

Who localised this protein by microscopy?

Shea, M., Jakle, U., Liu, Q., Berry, C., Joiner, K. A., Soldati-Favre, D.
A family of aspartic proteases and a novel, dynamic and cell-cycle-dependent protease localization in the secretory pathway of Toxoplasma gondii. (2007 Aug, Traffic) PubMed / full text
   more detail about this publication

microneme during intracellular tachyzoite

Meissner, M., Reiss, M., Viebig, N., Carruthers, V. B., Toursel, C., Tomavo, S., Ajioka, J. W., Soldati, D.
A family of transmembrane microneme proteins of Toxoplasma gondii contain EGF-like domains and function as escorters. (2002 Feb 1, J Cell Sci) PubMed / full text
   more detail about this publication

microneme during intracellular tachyzoite
  • "TgMIC6 and TgMIC8 are microneme proteins, processed at their C-terminus upon secretion."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: RH
  • Gene model mapping comments: inferred from another publication
  • Localisation record: microneme during intracellular tachyzoite
  • Other genes localised in this publication: microneme protein MIC3, microneme protein 7, microneme protein 8

Reiss, M., Viebig, N., Brecht, S., Fourmaux, M. N., Soete, M., Di Cristina, M., Dubremetz, J. F., Soldati, D.
Identification and characterization of an escorter for two secretory adhesins in Toxoplasma gondii. (2001 Feb 5, J Cell Biol) PubMed / full text
   more detail about this publication

microneme during tachyzoite
  • "We have identified a transmembrane micronemal protein MIC6, which functions as an escorter for the accurate targeting of two soluble proteins MIC1 and MIC4 to the micronemes."
  • Microscopy type: Light and EM
  • Microscopy method: antibody directly to protein
  • Strain: RH
  • Gene model mapping comments: Blast from AAD28185, annotation matches
  • Localisation record: microneme during tachyzoite
  • Comment: disruption of TgMIC6 results in mistrafficking of TgMIC4 and TgMIC1 to dense granules, the “default” secretory pathway
  • Other genes localised in this publication: microneme protein MIC1, microneme protein MIC4, SRS29B (= SAG1, P30)

Orthology

OrthoMCL

Part of OrthoMCL group OG4_116072

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>TGME49_018520 microneme protein MIC6
MRLFRCCAAAVVAAESLLWLKNGSPFFAFLPGNGEIADNCSGNPCGGTAAGTCINTPSGYDCRCEPGYVLGVENDQVTCM
MPSGVPMANFVQLSEKPAACSSNPCGPEAAGTCNETNSGYICRCNQGYRISLDGTGNVTCIVRQESGCEENGCGPPDAVQ
SCRRLTGTAGRLCVCKENFIATIDASAHITCKRVPPHYRKPPFEFGKGGHPVDSEPSKRQREDEGESREPESDSTEPGRD
QERRTPLEESQEPEGSTPDSQQSRGGSGSDSTESEEQGKEREEGSGHAGAIAGGVIGGLLLLSAAGAGVAYMRKSGSGGG
EEIEYERGIEAAEASEVEVLVDLDSKTWD

Gene-Specific Links for TGME49_018520

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins