ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_018360 (ZFP1) *

* The amino acid sequence is recorded as differing between ApiLoc and the genome database. See the gene model mapping comments in each localisation for more information.

zinc finger (CCCH type) protein, putative, a gene from Toxoplasma gondii

Compiled localisation
nucleolus during tachyzoite

Who localised this protein by microscopy?

Vanchinathan, P., Brewer, J. L., Harb, O. S., Boothroyd, J. C., Singh, U.
Disruption of a locus encoding a nucleolar zinc finger protein decreases tachyzoite-to-bradyzoite differentiation in Toxoplasma gondii. (2005 Oct, Infect Immun) PubMed / full text
   more detail about this publication

nucleolus during tachyzoite
  • "ZFP1 is targeted to the parasite nucleolus by CCHC motifs and significantly altered expression levels are toxic to the parasites."
  • Microscopy type: Light
  • Microscopy method: YFP tag, HA tag
  • Strain: Pru hxgprt-
  • Gene model mapping comments: blast from figure 1 protein sequence MARTLSGSCDSARHFPFATGNGNKKRRRQSEIDTPSDPKSTDDASAADGVRLKKKCVGRRTNEKTHRSASPKGASRKSESGRRKEKQLTSHDNDSQGEENEGDFPQAAEGRDSDVADLGNDDQSVTSEEADAAGSAGVKDKPVMRKKRKRRECWTIEQVRERMAELVAELENRSEMTKSRQKRLRARLALLAKAERGEIKVGGQLEKSKKKLKAAQQAKQGGKGKSKNLASKRDSTKGTQKPHLASKKLTGSQKKKLNKiCLRCREKGHVLENCPLAQSSATGSSAAENVAKQSDAKAGPLMSGICFNCGATDHTLKNCKKKRKPHGALPFALCFICGEKGHLSSGCPKSKTGKYPQGGSCHTCGSIYHLQIECPEFQRQQKERSNQEKQSRAKGNSRGRTENRNENKQKMQTTERGSATGGKVHRKIQEPDPDEFWMGQSA, gene model inconsistent
  • Localisation record: nucleolus during tachyzoite
  • Comment: protein sequence taken from OCR of figure 1, so may be slightly incorrect
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_68612

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>TGME49_018360 zinc finger (CCCH type) protein, putative
MARTLSGSCDSARHFPFATGNGNKKRRRQSEIDTPSDPKSTDDASAADGVRLKKKCVGRRTNEKTHRSASPKGASRKSES
GRRKEKQLTSHDNDSQGEENEGDFPQAAEGRDSDVADLGNDDQSVTSEEADAAGSAGVKDKPVMRKKRKRRECWTIEQVR
ERMAELVAELENRSEMTKSRQKRLRARLALLAKAERGEIKVGGQLEKSKKKLKAAQQAKQGGKGKSKNLASKRDSTKGTQ
KPHLASKKLTGSQKKKLNKICLRCREKGHVLENCPLAQSSATGSSAAENVAKQSDAKAGPLMSGICFNCGATDHTLKNCK
KKRKPHGALPFALCFICGEKGHLSSGCPKSKTAPSGRPIPSAQQSNLVREIFWKTQLCPKLHSTGVCPRKDHCSFAHSQE
ELRTPPDLRCTKWCRRVFRGQICEDPGCPYAHSKEDLRCNGHQLLTFKTAMCKFHAKGVCLSGASCRFAHTAEELRGGPD
EASTHSEDRLQDTSRGSISTSSEASGHDCRESAAAHVVTSAIQALQSLNKTNRKSPREANSEWQDEKGHSSVGLASWKKG
EPEDEPLPSQSHNIASEKFHRGTHLKPRVGVGIHHHGHSQPPAGGHAGLATEREKPTVCVVEIHGRGPCEPGAFHVTNTA
LRKVPLNVESDTSRSSSLHQLRPQEPKMRASAWKETKTREGQSRRCGSVCGQQNEKQTTVPKAGLLTYKVTLSRGREILP
LSGLDATPVHIVVGPREESALVSDESLRAADGVSASHPEKSFAKETASRSSSSDSRQSLNSSSLNPGAAPFIPTLLLGSS
TQHGTQFGASSPLAGVGNLEAASSLSSDTPSLSAREKFLTHGANAPHSSRGSSVGGTGGIDLAKFLQDSMAAPLVSSQGQ
YRDEWLLREFRNEASATGTTSAKVSCNGISHRGTSGAGMNNTLFPGLPTAVAGVRGENQGAAALAALVAVSRLLSPPGNV
PPVSGPSTTQKSPVAFFTSSHSGAPGDIPDQSRRVPGLAQETNSSNSNAWTTLVAALLAMAPHVGKGGAPPAAQTSVAYP
SVPSQTPEPSSVFLQTRWVGSCGHPCAPNPTRPVRNLAGSGSRYVPPEPFSQQMQYCSSPEEASRNLPHRGVPFLPGGLS
SVGQPSRPPAVRPLPSGFEASAALSACLSAVPVPPAPHPIQPYGQLKKFLGISPVNCHNGPPLRPHPSSSFPDPLAFANR
HGSLSRHQEALFPAAVDSQSYDGACLRGRTDAGWCDAFSASSFSEALRAASPSRQTEHVKGPSAPLVRPTGDSEGNGLAV
AQRGQNANHAVTASAFIDVPTSAVFLNDSQRTANQREAQAYHGRMTLSTDDGLGKEDLDVPSPFLTVTTEPGASLGSRGS
FAAHEDLLSSVSGVDLEADASKGVLLFGDEREANSEIWANL

Gene-Specific Links for TGME49_018360

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins