ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_018280 ()

eukaryotic porin domain-containing protein, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_21960

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • PFF0825c mitochondrial import receptor subunit tom40, putative
  • PBANKA_111650 mitochondrial import receptor subunit, putative
  • PY05229 probable mitochondrial import receptor subunit tom40 homolog
  • PVX_113990 mitochondrial import receptor subunit tom40, putative
  • PCHAS_111610 mitochondrial import receptor subunit, putative
  • PKH_113200 Mitochondrial import receptor, putative
  • TGME49_018280 eukaryotic porin domain-containing protein
  • NCLIV_061940 hypothetical protein
  • cgd1_2560 Tom40p like translocase
  • Chro.10287 mitochondrial import receptor subunit tom40
  • CMU_029330 eukaryotic porin family protein
  • TP01_1046 mitochondrial import receptor subunit tom40, putative
  • TA16995 porin, putative
  • BBOV_III011760 conserved hypothetical protein
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>TGME49_018280 eukaryotic porin domain-containing protein
MKTSSRHEEQQHRPGFRFCRFLRGMTLAGGDRGTGSLLLRSLHPGALTGVAASCAEKEEKSFLSGFPSFGLFDKNSSKDA
AAKSSSSVSADASTPSRPASSGDTDTMEGSSEARPPLSTAALAPGTSMLGSSEAGESTSNRLIPSESKELDKTRAPIPVP
YEQFSREWMAVAGQDNFDGFRLEATKQVNKVLTANHTFMLGTQSKEGGCSYSFGPTLVIGEPDEAAQQEGQMPNFFGMAR
MNSDGFLQARFIKAISKTFDIKFNSNSSISEDAKDKSMYEVSFDKMGSDWAANLKLAWQGTWILNGLFSQVITPKLQLGG
ELTWVAATGISMGSVGARYGFNENNTVTCQIGVGPDFSSPMGFANDVYSTKAQYVRKVTDRLSMGTELEFTHPDMSSAMR
VGWQYLFRQARVQGLVDTAGRVSMFAQDYNGFGLSGMIDYWHGDYKFGFQMNVVPPPPQAEQPPPM

Gene-Specific Links for TGME49_018280

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins