ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_018260 (H3.3)

histone H3.3 variant, a gene from Toxoplasma gondii

Compiled localisation
nucleus during tachyzoite

Who localised this protein by microscopy?

Brooks, C. F., Francia, M. E., Gissot, M., Croken, M. M., Kim, K., Striepen, B.
Toxoplasma gondii sequesters centromeres to a specific nuclear region throughout the cell cycle. (2011 Mar 1, Proc Natl Acad Sci U S A) PubMed / full text
   more detail about this publication

nucleus during tachyzoite
  • "As expected, histones H3 and H3.3 label the entire nucleus"
  • Microscopy type: fixed light
  • Microscopy method: antibody to YFP tag
  • Strain: RH
  • Gene model mapping comments: Taken directly from publication
  • Localisation record: nucleus during tachyzoite
  • Other genes localised in this publication: histone H3 variant, putative, histone H3

Orthology

OrthoMCL

This gene does not have an OrthoMCL group.

Amino Acid Sequence

>TGME49_018260 histone H3.3 variant
MARTKQTARKSTGGIKKPHRYRPGTVALREIRKFQKSTDLLIRKLPFQRLVREIAQDFKTDLRFQSQAILALQEAAEAYL
VGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERS

Gene-Specific Links for TGME49_018260

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins