ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_017820 ()

proteasome PCI domain-containing protein, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_12501

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • PFD0880w golgi organization and biogenesis factor, putative
  • PBANKA_072030 proteasome regulatory component, putative
  • PY03267 unknown protein, putative
  • PVX_090000 hypothetical protein, conserved
  • PCHAS_072930 proteasome regulatory component, putative
  • PKH_052230 hypothetical protein, conserved in Apicomplexan species
  • TGME49_017820 proteasome PCI domain-containing protein
  • NCLIV_062570 Contig An13c0020, complete genome, related
  • cgd1_3480 predicted proteasome regulatory complex component with a PINT domain at the C-terminus
  • Chro.10388 hypothetical protein
  • CMU_020120 PCI domain-containing protein
  • TA08215 hypothetical protein, conserved
  • BBOV_II001840 PCI domain containing protein
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_017820 proteasome PCI domain-containing protein
MTTFVPLATDGDGTASAVAVGDWLLQIINLKNPSQTQSYYTQFLEQFDKDEETGEQKIRDHFQLFELLLSQHQLVFNYAT
QARQPAAAEKGEKPQNRKTFLEAVHEVEEFFTVLIAMVVLRIENVEQAGQAAGTLCSVFRASTDMAEFRLRLLQSLYNAF
PPSFPYRFPIFVATLEYAAETNLFSVMLPYIRYINEWMRDWNLPPSSKRQVFLILANELKKLKKADEAYPFLKRHVQFFQ
NEKEEILSNGATISAAVELVEDSIRLPDVIVFDGLMDLHAVVHLRKTAHAPLIELLQIFVNQGPKELEAFKNKHPQVFEE
HGLNYEQCLGKIRLLAVASLVHGRKKEVSIRAIGDALQLSEAGAEEVAVQAIGQGIVDAKIDQLARVLHVRSTMQREFGR
QQWEELLERIDHWSEGVRALMGCMQSVKNQVASAAASAAGSSPGGLASPGASLASGGIATPQQ

Gene-Specific Links for TGME49_017820

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins