ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_017740 ()

oxoacyl-ACP reductase, putative, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10098

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • PFI1125c beta-ketoacyl-acyl carrier protein reductase
  • NCLIV_062520 3-ketoacyl-(Acyl-carrier-protein) reductase (EC 1.1.1.100), related
  • PBANKA_082380 3-oxoacyl-(acyl-carrier protein) reductase, putative
  • PCHAS_082410 3-oxoacyl-(acyl-carrier protein) reductase, putative
  • PVX_099555 3-oxoacyl-(acyl-carrier protein) reductase, putative
  • TGME49_017740 oxoacyl-ACP reductase, putative
  • PKH_072010 3-oxoacyl-(acyl-carrier protein) reductase, putative
  • PY02416 3-oxoacyl-acyl-carrier protein reductase precursor
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_017740 oxoacyl-ACP reductase, putative
METPVSVQTARRPSSSRSLNLLTLALSLFFAPTVSARLVASTAPASSFSGASGFLSPVPLGFSAAAPLRGASSRPIQAHG
DGSAHSANALPSSSPSSFLRGQASDARPLSTTSCSAYKLTFGGPETGEKDGRVALVTGASRGIGKAIADALAEGGVSHLI
CVARQQAACDEAAADLRRRGFSASGHAVDVGDGPAVAALCEELLQQYPHIDILVNNAGITRDNLFIRMNEQEWNDVINTN
LNSAFYFSSHIIKRMVKNRFGRIINISSVIGVGGNPGQANYAASKAGMIGLTRTLGKEYANRNITVNAIAPGFIRSAMTD
KMPEEAKKHAMAQIPANRLGEPKDVAALAAFLASDQAGYITGKVIPVDGGMLFGGN

Gene-Specific Links for TGME49_017740

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins