ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_017460 (GlnRS) *

* The amino acid sequence is recorded as differing between ApiLoc and the genome database. See the gene model mapping comments in each localisation for more information.

glutaminyl-tRNA synthetase, putative, a gene from Toxoplasma gondii

Compiled localisation
cytosol and not apicoplast and not mitochondrion during tachyzoite

Who localised this protein by microscopy?

Pino, P., Aeby, E., Foth, B. J., Sheiner, L., Soldati, T., Schneider, A., Soldati-Favre, D.
Mitochondrial translation in absence of local tRNA aminoacylation and methionyl tRNA Met formylation in Apicomplexa. (2010 May, Mol Microbiol) PubMed / full text
   more detail about this publication

cytosol and not apicoplast and not mitochondrion during tachyzoite

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10939

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • PF13_0170 glutaminyl-tRNA synthetase, putative
  • PBANKA_134660 glutaminyl-tRNA synthetase, putative
  • PY02178 glutaminyl-tRNA synthetase, putative
  • PVX_082520 glutaminyl-tRNA synthetase, putative
  • PCHAS_135120 glutaminyl-tRNA synthetase, putative
  • PKH_122110 glutaminyl-tRNA synthetase, putative
  • NCLIV_062220 Glutaminyl-tRNA synthetase (EC 6.1.1.18), related
  • NCLIV_062230 Glutaminyl-tRNA synthetase (EC 6.1.1.18), related
  • cgd1_2130 glutaminyl-tRNA synthetase, of predicted bacterial origin
  • Chro.10244 glutaminyl-tRNA synthetase
  • CMU_028890 glutaminyl-tRNA synthetase family protein
  • TP02_0322 glutaminyl-tRNA synthetase, putative
  • TA12530 glutaminyl-trna synthetase, putative
  • BBOV_III006400 glutaminyl-tRNA synthetase family protein
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_017460 glutaminyl-tRNA synthetase, putative
MALSPGAVLRITRLASLPPLSTVTDVVLAYIEQNLKSAGDFTFSVQPDTSSTPAAPFRIAVETKKGEQPSPIAAGEALSD
YAAARCIARLAASTGDPFASLLKASGAPGGVEAAVDVCEQWAAFYGVSGKAPEASDNPGLSACIDFFARRFSTSSSFLFG
TPQPSLADMTLFALLKAHPAAQTALSSALRTSETAAKHFSSWSACVAKAIPGAGALSGAGAKGTDRAKGKSGEMVGQGAG
VASEAVDGPDATTSVNFLKQIVEEDLRTGKHKTVITRFPPEPNGFLHLGHAKSVCLNFGLAKAFGGRCHLRFDDTNPMKE
ETRYIESIQRDVRWLGGDWGNHLYYASDYFQQLYDWAELLIKKGLAFVDDDSLEEIRRKRGSISQPGENSPFRERSIEEN
LDLFRRMRAGEFEEGSRVLRAKIDMTHSNMNMRDPVLYRILKKEHPRTGNQWVIYPMYDYAHGQSDSIENITHSICTLEF
DLHRILYDWFQEKLEITRTRQIEFARLNVTYTVMSKRKLLALVTEKWVDGWDDPRLPTLSGLRRRGVPPSALRDFCDKVG
VARRESTIKVEVLEKCIRDALHVVAHRRFAIQDPIAVTITNYGDKVETITAANHPEDESFGTRELHFSKKLYIDRDDFME
NPPAGYRRLAPGAEVRLKHAYWIKCVDVVKDASGLVTELLCTYDPQTKNCSVAPDGRKVKGAIHWLSEKDAVPAEIRIFG
RLFTKPNPEEEDESNPNASWRENINKESLKVYKGFVERSAADSAAFPPQSSLQFERLGFFTPDGSTLPEEADNTKTRTLP
VFNLTVALQEGFTAADDAEKDKTKQQERLAREKAALERQKKKEEKEARKKMKEQQQTVQA

Gene-Specific Links for TGME49_017460

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins