ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_016930 ()

cholinephosphate cytidylyltransferase, putative, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_11749

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • MAL13P1.86 cholinephosphate cytidylyltransferase
  • PY02436 cholinephosphate cytidylyltransferase
  • PVX_122650 cholinephosphate cytidylyltransferase, putative
  • PCHAS_141690 cholinephosphate cytidylyltransferase, putative
  • PKH_141580 cholinephosphate cytidylyltransferase, putative
  • TGME49_016930 cholinephosphate cytidylyltransferase, putative
  • NCLIV_059380 SJCHGC06128 protein, related
  • cgd8_1150 choline-phosphate cytidylyltransferase
  • Chro.80135 cholinephosphate cytidylyltransferase
  • CMU_025070 choline-phophate cytidylyltransferase protein, putative
  • TP02_0826 cholinephosphate cytidylyltransferase, putative
  • TA15365 CTP:phosphorylcholine cytidylyltransferase, putative
  • BBOV_II005220 choline-phosphate cytidylyltransferase
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_016930 cholinephosphate cytidylyltransferase, putative
MEAVSSSSDGLPTKRKETHAEESDPPPEPPTKKMKRERETSSDPNEWGRPIRVYADGVYDLLHLGHMRQLEQAKKLFKNV
HLIAGVASDEDTHRLKGQTVQTMTERAETLRHIKWVDEVIAPCPWILTPEFIEEHKIDFVAHDAEPYQAVQKSKDKDKKE
RGERKKKKTAPADDDIYGWLKEAGKFKATKRTAGVSTTDLIVRILQNYEDYVDRSLQRGVTPKDMNIGFTTANAIKMKKN
MQRWGEKVSDELTKVTLTDRPLGVNFDESVEKLRNSIHEKYDSWRAHSHKFLKGFARTFEPMKSFIGLHHKSPRHTSDEE
DGAASDASQ

Gene-Specific Links for TGME49_016930

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins